KEGG   Bartonella australis: BAnh1_08420Help
Entry
BAnh1_08420       CDS       T02469                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
baus  Bartonella australis
Pathway
baus00471  D-Glutamine and D-glutamate metabolism
baus00550  Peptidoglycan biosynthesis
baus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baus00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BAnh1_08420 (murD)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAnh1_08420 (murD)
Enzymes [BR:baus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BAnh1_08420 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:baus01011]
 Precursor biosynthesis
  Amino acid ligase
   BAnh1_08420 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C TrkA_N CbiA NAD_binding_2 AceK UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGF74718
UniProt: M1NTT0
Position
complement(1057557..1058954)
Genome map
AA seq 465 aa AA seqDB search
MISVECYKGQKVALLGLGRSGLATAQALIAGGAEVVAWDDNLSCVEAAREKNIPTKNLYY
EDWSEFIALVLAPGVPLTHPKPHWAVSRAQQAGVEIVGDVELFVRARNHFLQQHGFCDQD
VPFIAITGTNGKSTTTTLLVHLLEQTGYDVQMGGNIGTPILTLKPFVEKRIYVIECSSFQ
IDLTPSLRPTVGLLLNLTPDHIDRHGSFAYYAQVKGRLVSKAFHALISINDAVCGALYQR
LVNEGHQVEAISEGHVIENGFYAEGTKLFSVRHGRRYMLADLADMDSLRGSHNVQNALMA
LATLQVLKISDLDIEKHLASYVGLAHRMQRVCKIGSVLFINDSKATNAEASAFALSTFDD
IFWIVGGQAKEGGINILKRFFSKIRKAYLIGASAEKFSHVIGSAFPFSVSLTLENAVREA
AVDAAYDATKESVVLFSPACASYDQFRNYEERGEAFISFVTQLEK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctgttgaatgttataaaggtcaaaaagttgccttactgggactagggcggtcg
gggttggctacggcacaggcgctcattgctggtggagcagaagtggttgcgtgggatgat
aatctttcttgcgtagaagctgctcgtgagaaaaatattccaacgaaaaatctctattat
gaggattggtcagaatttattgcgttggttctagcacctggagtgcctttaactcatcct
aagcctcattgggcagttagtagggcacagcaggcgggcgtagaaattgtcggcgatgtt
gaactatttgttcgtgcacgaaatcattttttacagcagcatggtttttgcgatcaagat
gttccattcattgccattacaggtacgaatggcaaatcaacgacgacaactttgctcgtc
catcttttagagcagacaggttatgatgtacaaatgggggggaatatagggactcccata
ttaacgctaaagccgtttgtagagaagcgcatttatgtcattgaatgttcgtcatttcaa
attgatttaacgccgtctcttcgaccaacagtgggccttttattaaatttgacacctgat
catattgatcgtcatggtagttttgcctattacgcgcaagtcaaggggcgtttagtttct
aaagcttttcacgcattgatttcaattaatgacgcggtttgtggagctctatatcaacgg
cttgtgaatgaaggccaccaagtagaagcaatttctgaggggcatgttatcgaaaatggt
ttttatgcggaaggaacaaaactcttctctgtccgtcacgggcggcgttatatgctcgca
gatcttgctgatatggattcactgcgtggcagccataacgtgcagaacgctctcatggct
ttagcgacattgcaagtgctaaaaataagtgatctggatatagagaaacatttagcaagt
tatgtagggcttgcgcatcgtatgcaacgggtttgcaaaatcggatcagttttatttatt
aatgatagtaaagctactaatgcagaggcgtcggctttcgcactttctacttttgatgat
attttttggatcgttggagggcaagcgaaagaaggtggaattaatatccttaaaagattt
tttagtaaaattcgtaaagcttatttaattggtgcttccgcggaaaaattctctcacgtt
attggttctgcctttcctttttctgtgagtttaacactggaaaatgcggtgcgtgaagca
gccgttgatgcggcttatgatgctacaaaagaatccgttgttttattttcaccagcctgt
gcaagttacgatcaatttagaaattatgaagagcgtggagaggccttcatttctttcgtt
acacagttagagaagtga

DBGET integrated database retrieval system