KEGG   Bartonella australis: BAnh1_08470Help
Entry
BAnh1_08470       CDS       T02469                                 

Definition
(GenBank) hypothetical protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shugoshin_N DUF5489
Motif
Other DBs
NCBI-ProteinID: AGF74723
UniProt: M1NTT5
Position
complement(1064695..1065099)
Genome map
AA seq 134 aa AA seqDB search
MVMFRTLDVILVVIMICMAGLTYKVKCDVQKQIGEVHRIEREIAAEKDMVNLFYAEWAVM
IEPSRMEKLAKRYQKELNLEMIQPRQVVELRDIPLGWHDQIGELIKQNSFIAGKISPLNN
HVSHINRVVQRGAR
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggtaatgtttcgcacattagatgtgattttagtggtgatcatgatctgtatggcaggc
cttacttataaggtgaagtgtgatgttcaaaaacaaattggtgaagttcaccgtattgag
cgcgaaattgcagccgagaaagatatggttaatttgttttatgctgagtgggctgtgatg
atagaaccttcacgcatggaaaaactggcaaaacgttatcaaaaagagcttaatttggag
atgatacagccccgccaagttgtcgaactgcgagatattccattaggctggcatgatcaa
attggagaattgatcaaacaaaacagttttatagcgggtaagatttctcctcttaataat
catgtttctcatattaatagagttgtccaaagaggcgcgcggtga

DBGET integrated database retrieval system