KEGG   Bartonella australis: BAnh1_08490Help
Entry
BAnh1_08490       CDS       T02469                                 

Definition
(GenBank) hypothetical protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1066820..1067332)
Genome map
AA seq 170 aa AA seqDB search
MRFLKIFLSTAFAVSFLFGVNKTHAVLVASAPTKSLAAVFSGGSVRPYEALIKKIANKYK
VPVSLAHAVISVESNYKARAKGSAGEIGLMQIKPSTARGLGFSGPVRDLYNPAINLEYGM
RYLAQARQLSGGNTCRTILKYNAGHAAKKMNPISARYCEKVKMYLASLKR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttctgaaaatctttttaagtacggcgtttgctgtgtcttttttattcggtgta
aataaaactcacgcagtactagttgcttcggctccgactaagagtttagctgctgttttt
tccggggggtccgttcgtccttatgaagctctcataaaaaaaattgcaaataagtataaa
gtaccggtcagtttggcgcatgccgttataagcgttgagagtaattataaagcgcgtgca
aaaggttccgctggtgaaataggtttgatgcaaattaaaccatctaccgcgcgggggctc
gggttcagcggccccgtgcgggatctttataatcctgcaattaaccttgaatatggcatg
cgttatctagcacaggcgcgtcaattaagcggcggtaatacatgtcgtacgattcttaaa
tataacgctggtcacgctgcgaaaaagatgaatcccatttcagccagatattgtgaaaaa
gttaaaatgtatttagcttcgttgaagcggtaa

DBGET integrated database retrieval system