KEGG   Bartonella australis: BAnh1_08520Help
Entry
BAnh1_08520       CDS       T02469                                 

Definition
(GenBank) putative membrane protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGF74728
UniProt: M1NTU1
Position
1070893..1071402
Genome map
AA seq 169 aa AA seqDB search
MSKKQIHLAVPETCHQALSLFAAPDIKLYFYRIKPVYQCTIERREKPVLYAPSFLALWAL
HYSVQNPHLFSSILCYGEQQYSPLAFMWFKLRLKIERYLMGSDVSSPIITRALRRHTANA
DYSALPIGTWLQLAKNYQNHRENSPVTLFWLDKHKNSADLHQMILKLQN
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaacaaatacacttggctgttcctgaaacatgccatcaagcgttgtctctt
ttcgctgcaccagacataaaactgtatttttaccgtatcaaaccagtctatcaatgcacc
atagagcggcgagaaaagccggttctctacgctccatcgttcctcgcattatgggcttta
cattactccgtacaaaacccacacctcttttcatcaatattatgttatggggagcaacaa
tattcacctcttgcctttatgtggttcaaactacgtttaaaaattgaacgctacctcatg
ggatctgacgtctcaagccccataattactcgagctttgcgccgacataccgcgaatgct
gactatagcgcattgcctattggaacatggctacaattagcaaaaaattaccaaaatcat
cgtgaaaactcgcccgttactctcttttggcttgataagcataaaaatagcgctgacctt
caccaaatgattttgaaacttcaaaactga

DBGET integrated database retrieval system