KEGG   Bartonella australis: BAnh1_08560Help
Entry
BAnh1_08560       CDS       T02469                                 

Definition
(GenBank) hypothetical protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1508
Motif
Other DBs
NCBI-ProteinID: AGF74732
UniProt: M1NZ62
Position
1074494..1074673
Genome map
AA seq 59 aa AA seqDB search
MCFEIFQGVRDRWYWRLISEDERKIAFSSKGYLTKQDILRDIDKVKKVAHGAFVKELSL
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
gtgtgttttgaaatatttcagggtgttcgtgatcgatggtactggcgtttaatttcagaa
gatgagcgaaagattgctttctctagtaagggttatctaacgaagcaggatatcctaagg
gatattgataaagttaaaaaggtcgcgcacggcgcttttgtaaaagaattgtcgctctag

DBGET integrated database retrieval system