KEGG   Bartonella australis: BAnh1_08690Help
Entry
BAnh1_08690       CDS       T02469                                 

Definition
(GenBank) transcription regulator, LysR family
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2 HTH_24
Motif
Other DBs
NCBI-ProteinID: AGF74745
UniProt: M1P4G3
Position
complement(1101010..1101915)
Genome map
AA seq 301 aa AA seqDB search
MTSPLDWDKLRVFHAAAEAGSFTHAAQRLHLSQSAISRQVSALEQDVGVPLFQRHARGLI
LTEQGEILYRAAHDVLMKLENTRLQLNESREKPTGRLRVTSTFGMGAGWLAERMPEFLDL
YPDMRVQILLNDEELDLTMRYADCAIRLHQPQQPDLIQRKLFTVHMHVYASEGYIAKYGK
PEKLSELDAHRIISFGQPVPHYLSGLNWLEKAGRNDGSLRASVLQINNIISIKNAIMRNF
GIAVLPDYIAHNNEQLVRLFPDTTDIPSFDTFFCYPDALKNLAKLNAFRDYIFLKARKWS
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcaccgctagattgggataagttaagagtttttcacgctgcggcagaggcaggt
tcttttacgcacgcagctcagcgtcttcatttatctcaatcggcaatttcgcgacaggtt
tcggctttagagcaggacgtcggtgtgcccttatttcaacgtcatgcacgtggtttaatt
ttaacagagcagggcgagattctttaccgcgcagcccatgatgtcttaatgaaactagaa
aatacgcgtttgcaattaaatgaaagtcgtgaaaagccaacggggcgtttacgcgtcaca
tcgacttttgggatgggggcagggtggcttgcagagcgtatgcccgaattcctggacctt
tatcccgatatgcgcgtccaaattttgctcaatgacgaagagcttgacttaacaatgcgt
tatgcagattgtgctatccgcttacatcagccgcagcaacctgatttgatacaaagaaaa
ttatttacggttcatatgcatgtttatgcttcggaaggttatatagcgaagtatggtaag
ccagaaaaattatctgagctggatgcacatcgtattatttcatttggtcaaccggttcca
cattatctatctggcttaaattggctagaaaaggctggaagaaatgatggttccttgcgt
gcttcagtgctacaaattaacaatataatctctattaaaaatgcaattatgcgcaatttt
ggtattgctgtacttcctgattatattgctcataataatgagcagcttgtgaggcttttt
cccgatacaactgatatcccttcctttgatacctttttttgttacccagatgctttgaaa
aatttagcaaagctgaatgcttttcgagattatattttcctaaaagctcgtaaatggtct
ttttaa

DBGET integrated database retrieval system