KEGG   Bartonella australis: BAnh1_08710Help
Entry
BAnh1_08710       CDS       T02469                                 

Gene name
trkH
Definition
(GenBank) trk system potassium uptake protein TrkH
  KO
K03498  
trk system potassium uptake protein
Organism
baus  Bartonella australis
Brite
Transporters [BR:baus02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BAnh1_08710 (trkH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1103241..1104635
Genome map
AA seq 464 aa AA seqDB search
MLLPIFVDLCDGNRSWVTFLHPCAVTVMLATLILLATRGSTCRFSARLGFTLTVCLWLTG
SIVGALPLYLSPLPISLAGAIFESVSGITTTGSTVIIGLDYLPRSILLWRSIMCWIGGIG
FIGLALLLLPSLRVGGVQLFHMESSDKSEKILPRINQIANGIITAYIGLTLACMISYFAA
GMTLFDSVNHAMSTIATAGFSTHDTSFGYFSNKPAILIVATIFMLFSALPFVLYVKLVLP
GHSKRSIDPQVIVFLNIVFFFSLALAVWLRFHNHLAFHSAFLDAIFHITSIISTTGYSAK
DYQLWGPFALGIFFIVSFAGGCAGSTSGGIKINRLIILWRIAQANMAKLLSPNAVVKVRY
DHSNVSSDIAKAVLLFVCLYMSCLLTGTALLLTTGLDFTSAFTGVLTALSNIGPGFGDII
GPAGNFSTINDNALWILSFLMLVGRLEIVTIFVLFIPAFWRKQF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcccgatttttgttgatttgtgcgatggcaaccgtagttgggtaacttttctc
catccttgcgccgtaaccgtcatgctggcaacactgatccttttagctaccagaggctct
acttgccgtttttcagcgcgacttggcttcactctgacagtttgtctttggctaacagga
agtatagtgggtgctctccctctttatctttctccgctcccgatttctctagccggagcg
atctttgaatctgtctctggaattacaactacaggctccacagtaatcattggtctcgac
tatttgccacgaagcattttattgtggcgttccattatgtgctggatcggtggcattggc
tttattggtttagctttattgctcttaccttcacttcgcgtcgggggagtgcagcttttt
catatggaatcatcagataaatctgaaaaaatactgccccgcatcaatcaaatcgctaac
ggaattattactgcttatatcgggctaacactcgcttgtatgatttcttattttgccgct
ggtatgaccttattcgattccgttaatcacgcgatgagtacgatagcgacagcaggtttt
tcaacgcacgatacctcttttggttatttttctaataaaccggccatcctgatcgttgcg
actatttttatgttgttttctgctttgcccttcgtgctttacgttaaattagtactccca
ggccactccaaacgctccattgatccgcaggttatcgtttttctaaatatagttttcttc
tttagccttgctttggctgtgtggctgcgatttcacaatcacctcgcatttcactcggcc
ttcctcgatgcaatttttcacatcacatctatcatcagcaccacaggctacagcgccaaa
gactaccaactttggggcccctttgcacttggtatttttttcattgtttcttttgcaggt
gggtgcgctggttctacctccggtggcataaaaataaaccgtttaattattctctggcgt
attgcgcaagcgaatatggcaaaacttctttctcctaacgcggttgtaaaagtccgatac
gatcactcaaatgtatcaagcgatatcgctaaagcagtccttctttttgtatgcctttat
atgtcttgtcttctcactggtaccgcacttttgcttacgaccgggctcgattttacttct
gcctttacaggtgtcttaacagcactttcgaatatcggcccaggttttggagatatcatc
ggtcctgccggtaatttctcaacaattaacgataatgctttatggattttgagcttttta
atgctggttggccgccttgaaatcgtgaccatatttgtgctttttatccctgcattctgg
cgcaaacaattttaa

DBGET integrated database retrieval system