KEGG   Bartonella australis: BAnh1_08810Help
Entry
BAnh1_08810       CDS       T02469                                 

Definition
(GenBank) hypothetical protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YbjN
Motif
Other DBs
NCBI-ProteinID: AGF74755
UniProt: M1P4H2
Position
complement(1114630..1115130)
Genome map
AA seq 166 aa AA seqDB search
MRLAFSTIKREEHPVDFIEQIAYKYDWSFERNVKDEISVCVEGKRANYRLAFSWIEEQEA
LHLACAFDLSIENARAMEVNRLLLAINEKLLLGHFDYWRGDNSVIYRQGLLLAGGAHPSH
IQVETLLIHALKVCESHYAAFQMVAWAGESARKALQYALFETVGNA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttgcctttagcactataaaaagagaagagcatccggtcgattttattgaacag
attgcctataaatacgattggtcttttgagcggaatgtaaaagatgaaattagcgtttgc
gtagaagggaaacgagctaattatcgccttgctttttcatggattgaagaacaagaagct
cttcatttagcctgtgcatttgatctgtctattgaaaatgctcgggcaatggaagtgaat
cgtttattgttggcaattaatgagaaattattgttgggacattttgattattggcggggg
gataattcggtcatttatcggcaaggccttcttcttgctggtggtgcgcatccatcccac
atacaggttgagacactgctaatacacgcactaaaagtttgcgaaagccattatgctgct
tttcaaatggttgcttgggccggcgaaagcgctcgtaaagcattacaatatgctctgttt
gaaactgtaggtaacgcctag

DBGET integrated database retrieval system