KEGG   Bartonella australis: BAnh1_08860Help
Entry
BAnh1_08860       CDS       T02469                                 

Gene name
prsA
Definition
(GenBank) ribose-phosphate pyrophosphokinase
  KO
K00948  
ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
baus  Bartonella australis
Pathway
Pentose phosphate pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:baus00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BAnh1_08860 (prsA)
  Nucleotide metabolism
   00230 Purine metabolism
    BAnh1_08860 (prsA)
Enzymes [BR:baus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     BAnh1_08860 (prsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1119177..1120109
Genome map
AA seq 310 aa AA seqDB search
MKLFCGNSNPRLAEDIANYLNISLGKATVKRFADQEIFVELHENVRGQDVFVLQSSSYPA
NDHLMELLIMIDALRRSSARRTTAVIPYFGYARQDRKPGPRTPISAKLVANLITEAGANR
VLTLDLHAGQIQGFFDIPTDNLYAVPVISRDVKMHYSLDNVIVVSPDVGGVVRARSLAKR
LNSLLAIVDKRRERPGESEVMNIIGNVSGKDCLLLDDIVDSGGTLCNAANALLEHGANSV
TAYITHGVLSGNAIERITNSALKELVITDSIMPTEKIERAHNIRVLAIADLIGEAIARTA
AEQSVSSLFS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttttttgcggtaattctaatccacgccttgccgaggatattgcaaattatctt
aacatctccctaggtaaagcaactgtaaaacgcttcgctgatcaagaaatttttgtggaa
ttgcatgaaaatgtgcgcgggcaagacgtatttgtactgcaatcctcatcttatcccgca
aacgatcacttgatggaattgcttatcatgattgatgcccttcgccgctcttcggcccgc
cgaactacggctgttataccttattttgggtacgcccgccaagaccgcaaacctggaccg
cgcacgcctatttctgcaaaacttgttgccaatctgattactgaagcaggcgccaaccgt
gttttaacattggatctgcacgctgggcaaattcagggtttttttgatattccaacggat
aatctttacgctgttcctgttatttctcgtgacgttaagatgcattattctcttgataat
gtcattgttgtttcacctgatgtcggtggtgtagtccgtgcgcgctccttagctaaacgc
ttaaacagtcttcttgctattgtcgacaaacgccgcgagcgcccgggtgaatcagaagtt
atgaacatcattggaaatgtatctggaaaagattgtcttttgctggatgatattgttgat
tcaggtggaaccctatgcaatgcagccaacgcccttctcgaacacggggcaaatagtgtc
actgcttatatcacgcacggcgttctttccggaaacgctatagaacgtatcactaattct
gcattaaaagaattagttattaccgattcaattatgccaacagaaaaaattgaacgagcg
cacaatatccgcgtcttagcaattgctgacttaataggagaagcaattgcgaggaccgcg
gcggagcagtctgtttcgagcttattcagctaa

DBGET integrated database retrieval system