KEGG   Bartonella australis: BAnh1_08860Help
Entry
BAnh1_08860       CDS       T02469                                 

Gene name
prsA
Definition
(GenBank) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
baus  Bartonella australis
Pathway
baus00030  Pentose phosphate pathway
baus00230  Purine metabolism
baus01100  Metabolic pathways
baus01110  Biosynthesis of secondary metabolites
baus01120  Microbial metabolism in diverse environments
baus01130  Biosynthesis of antibiotics
baus01200  Carbon metabolism
baus01230  Biosynthesis of amino acids
Module
baus_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:baus00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BAnh1_08860 (prsA)
  Nucleotide metabolism
   00230 Purine metabolism
    BAnh1_08860 (prsA)
Enzymes [BR:baus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     BAnh1_08860 (prsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: AGF74760
UniProt: M1P4H7
Position
1119177..1120109
Genome map
AA seq 310 aa AA seqDB search
MKLFCGNSNPRLAEDIANYLNISLGKATVKRFADQEIFVELHENVRGQDVFVLQSSSYPA
NDHLMELLIMIDALRRSSARRTTAVIPYFGYARQDRKPGPRTPISAKLVANLITEAGANR
VLTLDLHAGQIQGFFDIPTDNLYAVPVISRDVKMHYSLDNVIVVSPDVGGVVRARSLAKR
LNSLLAIVDKRRERPGESEVMNIIGNVSGKDCLLLDDIVDSGGTLCNAANALLEHGANSV
TAYITHGVLSGNAIERITNSALKELVITDSIMPTEKIERAHNIRVLAIADLIGEAIARTA
AEQSVSSLFS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttttttgcggtaattctaatccacgccttgccgaggatattgcaaattatctt
aacatctccctaggtaaagcaactgtaaaacgcttcgctgatcaagaaatttttgtggaa
ttgcatgaaaatgtgcgcgggcaagacgtatttgtactgcaatcctcatcttatcccgca
aacgatcacttgatggaattgcttatcatgattgatgcccttcgccgctcttcggcccgc
cgaactacggctgttataccttattttgggtacgcccgccaagaccgcaaacctggaccg
cgcacgcctatttctgcaaaacttgttgccaatctgattactgaagcaggcgccaaccgt
gttttaacattggatctgcacgctgggcaaattcagggtttttttgatattccaacggat
aatctttacgctgttcctgttatttctcgtgacgttaagatgcattattctcttgataat
gtcattgttgtttcacctgatgtcggtggtgtagtccgtgcgcgctccttagctaaacgc
ttaaacagtcttcttgctattgtcgacaaacgccgcgagcgcccgggtgaatcagaagtt
atgaacatcattggaaatgtatctggaaaagattgtcttttgctggatgatattgttgat
tcaggtggaaccctatgcaatgcagccaacgcccttctcgaacacggggcaaatagtgtc
actgcttatatcacgcacggcgttctttccggaaacgctatagaacgtatcactaattct
gcattaaaagaattagttattaccgattcaattatgccaacagaaaaaattgaacgagcg
cacaatatccgcgtcttagcaattgctgacttaataggagaagcaattgcgaggaccgcg
gcggagcagtctgtttcgagcttattcagctaa

DBGET integrated database retrieval system