KEGG   Bartonella australis: BAnh1_08880Help
Entry
BAnh1_08880       CDS       T02469                                 

Gene name
pth
Definition
(GenBank) peptidyl-tRNA hydrolase, PTH1 family
  KO
K01056  peptidyl-tRNA hydrolase, PTH1 family [EC:3.1.1.29]
Organism
baus  Bartonella australis
Brite
Enzymes [BR:baus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.29  aminoacyl-tRNA hydrolase
     BAnh1_08880 (pth)
Translation factors [BR:baus03012]
 Eukaryotic Type
  Release factors
   BAnh1_08880 (pth)
 Prokaryotic Type
   BAnh1_08880 (pth)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pept_tRNA_hydro
Motif
Other DBs
NCBI-ProteinID: AGF74762
UniProt: M1NZ98
Position
1121983..1122564
Genome map
AA seq 193 aa AA seqDB search
MLLIAGLGNPGSHYQNNRHNIGFMAVDAIHKSFPFSSWSKKFQAEISNCLIHGEKILLVK
PQTFMNLSGQAISEILQFYKLDLSNLIVIHDELNLPAGRVRIKTGGGSNGHNGIKSIDIH
CGNDYRRLRLGIGHPGSKELVSQYVLGNFTKSDQEWLPRLLNAIANNIVVLIKEDANRFM
NKICLATENKESQ
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttattgctggtctcggcaaccccggttcgcactatcaaaataaccgccataac
ataggtttcatggctgttgatgccattcacaaatcttttcccttttcttcatggtcaaaa
aaatttcaagccgaaatttctaactgccttatacatggcgaaaaaattcttctcgtaaaa
cctcaaactttcatgaatttatccggccaagccattagtgaaattttgcagttttataaa
ttagacttaagcaacttaattgtcatccatgatgaactcaatttgccagccgggagagtg
cgtataaaaaccggaggagggagtaatggacataacggcataaaatctatcgatattcat
tgcggcaacgattaccgccgcctgcgcttagggattgggcaccctggttccaaagaattg
gtttcacaatatgttttaggaaattttacaaaatccgatcaagaatggcttccccgttta
ttaaacgcaatcgcaaacaatattgtcgttttaatcaaggaagatgctaaccgctttatg
aataagatttgcttagcaacagaaaacaaagaatcacaatag

DBGET integrated database retrieval system