KEGG   Bartonella australis: BAnh1_08900Help
Entry
BAnh1_08900       CDS       T02469                                 

Definition
(GenBank) translation-associated GTPase
  KO
K06942  ribosome-binding ATPase
Organism
baus  Bartonella australis
Brite
Ribosome biogenesis [BR:baus03009]
 Prokaryotic Type
  Other maturation factors
   BAnh1_08900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YchF-GTPase_C MMR_HSR1 FeoB_N Pox_A51 PRA-PH
Motif
Other DBs
NCBI-ProteinID: AGF74764
UniProt: M1N4D5
Position
1124013..1125116
Genome map
AA seq 367 aa AA seqDB search
MGFKCGIVGLPNVGKSTLFNALTKTATAQAANYPFCTIEPNTGEVAVPDPRMQKIASIAC
SKEIIPARINFVDIAGLVRGASKGEGLGNKFLANIREVDAIIHVLRCFKDEDIAHVEGRI
DPVSDATTVETELMLADLESLERRILQIRKRATGKDREALSILPMMEAALKLLQKGHPVR
LLLKNISADERYILNSLNLLTSKPVLYVCNVSENDAARGNELTQAVEKMATEQNTQSIII
SASIESEIAQLTEEESVEYLSALGLTEPGLNRLIRAGYHLLDLITYFTCGPKETRAWTIV
RGAKAPQAAGIIHSDFERGFIRAQTISYEDYITSGGENGAKEAGKARDEGKEYIVQDGDI
MLFKHNT
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgggattcaaatgtggcatcgtcgggttgcctaatgttggcaaatcgactctttttaat
gcgttaacgaaaacagccacagcacaagctgctaattaccctttttgtacaatcgaacct
aacacaggtgaagtggctgtccctgatccgcgaatgcaaaaaattgcttccatcgcatgt
tccaaagaaataattcctgcacgtattaattttgttgatattgcagggctcgtgcgtggt
gcatcaaaaggcgaaggcctaggcaataaatttttagccaatattcgtgaagttgacgcc
attatccatgttttaaggtgtttcaaagatgaagatatcgcccatgtagaaggtcggatt
gaccctgtttctgatgcgacaaccgttgaaacagagcttatgcttgcagatctcgaaagt
cttgagcgacgaatcttacaaatccgcaaacgtgcaaccggaaaagacagagaagcgctg
tcgattcttcctatgatggaagcagcgttgaaattactacaaaaaggacaccctgtacgg
ttattgctcaaaaatatttccgctgacgagcgctatattcttaatagcctgaatctttta
acttctaagcccgtgctttatgtctgcaatgtaagcgaaaatgatgctgctcgtggtaat
gaattaactcaagcagttgaaaaaatggcaacagagcaaaacacgcaaagcattatcatt
tctgcctccatcgaatctgaaatcgcccaacttactgaagaagaatctgtagaatatctc
agcgccctagggctgactgaacctggccttaatcggcttattcgtgctggctatcatcta
cttgatttgattacttattttacttgtggacctaaagaaacacgggcatggacgatcgtc
cgcggcgctaaagcacctcaagcagctggaataattcactcagactttgaacgtggcttt
attcgcgcccaaactattagctacgaagattacattacctcaggtggagaaaatggagca
aaagaagcaggcaaagctcgtgatgaaggaaaagaatacatcgtgcaagacggcgacatc
atgctatttaaacataacacttaa

DBGET integrated database retrieval system