KEGG   Bartonella australis: BAnh1_08910Help
Entry
BAnh1_08910       CDS       T02469                                 

Definition
(GenBank) hypothetical protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRC
Motif
Other DBs
NCBI-ProteinID: AGF74765
UniProt: M1P4I2
Position
complement(1125279..1125710)
Genome map
AA seq 143 aa AA seqDB search
MKKIAFATFVSGLMVSSVYAQPSVMPSASEMISSTGIVQVDSNTVVRYVTPAATDFTASS
LIGAQVYNVDDENIGEVKDIILDKDDVGGFVIGVGGFLGIGERYVAVSPETVQMTNDYGK
WKFIINATKDSLKTAPEFKYEGR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgctttcgctacttttgtgtcaggccttatggtttctagtgtttatgcc
cagccttctgttatgccttctgcgtctgaaatgatttcatcaactggcatcgtacaggtc
gattcaaatacggtagtgcgttatgtcacgcctgctgcaactgactttactgcttcaagt
cttattggtgcacaagtgtataatgtagatgatgaaaatatcggtgaagtgaaagatatt
attttggacaaagatgacgtcgggggatttgtgattggtgtcggtggtttcctcggtata
ggtgaacgttatgttgctgtttctcccgaaacggtccagatgacaaatgattatggaaaa
tggaaatttattattaatgcaacgaaagattctcttaagacagccccagaatttaaatat
gaaggccgttga

DBGET integrated database retrieval system