KEGG   Bartonella australis: BAnh1_08960Help
Entry
BAnh1_08960       CDS       T02469                                 

Definition
(GenBank) hypothetical protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4159 BatA Glyco_tran_WecB YiiD_C
Motif
Other DBs
NCBI-ProteinID: AGF74770
UniProt: M1P4I8
Position
1131131..1133932
Genome map
AA seq 933 aa AA seqDB search
MSFGSPLLLLGLFALPLLWWLLKKTPPPPHKELFPPLRLLLKQAGQQTMADRTSWWMLLL
RLTIAASVIIALARPNWNEKPVMFSGSQQFALIIDNGWASAEAWQKRIAVAQSLLTQAEK
NKKSVYLLATAEDNTQIDLLSAKETIQHLRHLQSRPWPTNRVDALKKLIEKIGKETLDIV
YLSDGLQTSEDNQAFALIEQLKPQTLLWYSTDISNLVGITTIENDNGSMAARVIRATARG
KTAVTLNLYNAKNQLLGRFSASFREGETATLVPFNLPLELRNDIAWIKINDHPQAAATFL
VDKHNQINRVALLSPSINKMVQPLLSPFYYVIKALQGHAQLITAEGGELSGDISNLLEQN
PSVFIMGDIVNISKEAEKKLSDFVNKGGVLIRFAGENLSTAQHYDSLLPVPLRHGKRLLG
SVMSWAKPQKLASFTESKLFFDLPFPEDVTVSRQILAEPNSDLFEKTWLSLADGTPLITA
ATRGKGTLVFVHIAPDPTWSNLPLSGFFTQMLQKLIALSAHENETSMQIKAATIQPPWKI
LTADGQLQTPPSHVAPLVIDAQKPPLPSYRTPPGLYGFKDNLHAFNLLNHSSRLVKQSPL
PPYLNEVTLSYDIKEKDLTGLFFGLASLLLALDSFLVLWAGRAFFLNRKSSILLLLFCVA
SFDISPPNISVVHAQSSEKYNEITVQAAGSTHLAYVATNNYEIDATSKSGLETLSRFIAE
RTMLSPGSVVALDLDKDELAFYPLIYWPIDANSPMPTRKSLEKISAFMKHGGTILFDTRD
QISANLDLEGTATPASQRLRAILNELNIPSLEPASSDHVVARSFYIMPDFPGRYRGSLLW
VEASSVNKESKNSIAAGDNVSSLLITANNFADAWALDEKGTWKYPLVPNDPMQRLWAFRA
GLNIVIYTLTGNYKADQVHVPALLERFNRERRR
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
ttgagttttggatcccccttacttttgcttgggctttttgctttaccgcttctatggtgg
ttattgaaaaaaacacctcctcctcctcataaagagctctttcctcctttacgccttttg
ttgaagcaagctggtcagcaaacgatggctgaccgcacatcttggtggatgttattatta
cggttaactatagcggcctcggtcattattgccttagcacgtcctaattggaacgaaaaa
cctgttatgttttcggggtctcagcaatttgcgctcatcatcgataatgggtgggcatct
gccgaagcatggcaaaaacgcattgctgtcgcgcaatctctgctcacacaagcagagaaa
aacaagaagagtgtttatcttcttgcaacagctgaggacaatactcaaattgatcttcta
tctgcaaaagaaacaatacaacatttaaggcatttacaatctcggccttggcctactaac
cgtgtagatgcacttaaaaaactcattgaaaaaattggcaaagaaaccctcgatatcgtc
tacttgagcgatggactacaaacaagtgaagataatcaggcttttgctttaattgaacag
ttaaagccccaaacgctcctgtggtactcaactgatatctctaatctagtcggtataaca
accatagaaaatgataatggaagcatggcagcgcgcgttatccgtgcgaccgcccgcggt
aaaactgcggtgacattgaatctttataacgcaaaaaatcagctccttggccgttttagc
gcgagcttccgcgaaggagagaccgcaactctcgtccctttcaacttaccgcttgaattg
cgtaatgatattgcgtggattaaaattaacgaccatcctcaagctgccgcaacctttttg
gtcgacaaacataatcagataaatcgtgttgctctcctatcaccaagcatcaacaaaatg
gtacagcccctactttccccattttactacgttatcaaagcgctgcaagggcacgcacaa
cttattacagctgaaggaggagagctttcaggcgatatcagcaacttacttgaacaaaat
ccatctgtctttattatgggcgatatcgttaatatctcaaaagaagcagaaaaaaagctc
tccgattttgtgaataaagggggagtacttatccgctttgccggagagaatctgagcact
gcccaacattacgacagcttactccctgttccactacgtcacggaaaacgcctacttgga
agtgttatgtcgtgggcaaaaccgcaaaaactcgcatcttttacagaaagtaagcttttc
tttgatcttccttttccagaagacgttactgtctcacgtcaaatcttggcagaaccaaat
tcagatctttttgaaaaaacatggctcagccttgctgatggcactccccttattacagct
gctacccgaggcaaagggacgctcgtttttgttcatattgcgcctgatcccacatggtca
aacctcccgctttccggattttttacacaaatgttgcaaaagcttatcgcgctcagtgcg
cacgaaaatgagacctcgatgcaaataaaagcagcgacgatacagcccccttggaaaata
ttgacagccgacggccaattgcaaacacctccctcacatgttgccccgctggtcattgac
gcgcaaaaaccgcctcttccctcttaccgtaccccacccggactttacggctttaaagat
aatcttcatgcatttaatttactaaaccattcatcacgcttagtaaaacaatcaccgtta
ccaccctacctcaacgaagttactttatcctatgatataaaagaaaaagatcttaccgga
ctattttttggattagctagtttgttattagctctggacagctttttagttttatgggcg
ggtagagctttttttctcaaccgaaaaagcagtattctgcttcttctcttttgtgtggca
agcttcgacatttcaccccctaatatatcagttgttcatgcacaatcttctgaaaaatat
aatgaaatcaccgtgcaggcagctggttctacccatcttgcttatgtcgcaaccaataat
tatgaaattgacgcaacaagtaagagcgggctggagacgcttagtcgtttcattgcagaa
cgcacaatgctttcacctggttcagtggtagcacttgatcttgataaagacgaactggct
ttttatcctctcatttactggccaattgatgctaatagtcctatgccaacaagaaaaagc
ctcgaaaaaataagtgcttttatgaaacacggcggcacaattttatttgatactcgtgat
cagataagcgccaatctcgaccttgaaggaactgctaccccagccagccaaagattgcgt
gccatattaaatgaattaaacattccatcccttgaaccagcatcatccgatcacgtcgtt
gcccgttccttttatattatgcccgattttcctggacgctaccgcggttcacttttatgg
gttgaagcatcatcagtgaataaagagagcaaaaattctattgctgctggtgacaatgtc
agttctcttctgattaccgctaataatttcgctgacgcttgggctctggacgaaaaaggc
acatggaaatatccgcttgttcctaatgaccctatgcaacgtctttgggcatttcgtgca
ggattaaacattgtcatttatacgctcacgggaaactacaaagccgatcaggtacatgtt
cccgcactattagagcgctttaacagagaaagaaggcgatga

DBGET integrated database retrieval system