KEGG   Bartonella australis: BAnh1_08990Help
Entry
BAnh1_08990       CDS       T02469                                 

Definition
(GenBank) hypothetical protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1136791..1137426
Genome map
AA seq 211 aa AA seqDB search
MFYLAHISDVHLSPLPEPSLFELFGKRITGYLNWKKKRKGWMQPDVLDTLMHALKKKEPD
HLVISGDLVNLALDKEFEQARNWLLTQGEPRNISLTFGNHDAYVRGAFQKACTVFQPWIT
GDLSLKNNLPFPYMRIRDNVAIIGASSAIATPPFQAFGYFSGMQAQALSQLLHEAAERSL
FRIVMIHHPPFSPGRFLAQKTMGYRAFSKRY
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgttttatctagcccatatatcagatgtgcatctttcacctctgccagaaccgtcctta
tttgagctttttgggaaacgcattactggctatcttaattggaagaaaaaacgtaaaggc
tggatgcagccagatgttttagatactttaatgcacgcattaaaaaagaaggaacctgac
catcttgtgatttctggtgacctcgttaacctcgccttagataaagaatttgaacaagcg
cgcaactggttactcactcaaggtgaaccccgaaatatctctttaacgtttggtaatcat
gatgcctacgtccgtggggcgttccaaaaggcctgtactgtctttcaaccttggataacc
ggcgacctttcactaaagaacaaccttcccttcccctatatgcgtattcgcgataatgtc
gctattataggtgcttcttctgctatcgccacgccaccttttcaagctttcggatatttt
agcggcatgcaggcacaagctttatcccagcttttacacgaagctgcagaacgcagcctc
tttcgcattgtcatgattcaccacccccctttttcaccaggccgtttcttggcgcaaaaa
actatggggtatagagcgttttctaaacgttattaa

DBGET integrated database retrieval system