KEGG   Bartonella australis: BAnh1_09000Help
Entry
BAnh1_09000       CDS       T02469                                 

Definition
(GenBank) hypothetical protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cation_efflux ZT_dimer
Motif
Other DBs
NCBI-ProteinID: AGF74773
UniProt: M1NTY7
Position
complement(1138041..1138952)
Genome map
AA seq 303 aa AA seqDB search
MNTTTIEIQRLTIWSIVVACIVSALRYWAYYITGSVALYSDALESIVNVLSALAAWWAVK
VSTKPADQDHPFGHHKAEYFSAILEGVFIIIAAIVILKETWAAFSTVRPLQQPGTWIAIH
FVASIINYLWGAILIRQGKIYRSPALKADGVHLMTDVFTSLGILVGLLVAFLSGWAVLDP
ILAVIVAVHILLQGWKVVKNAAQGLMDAGVELSETVRIRDLISTNACGAIEVHDLRTRVA
GRATFIEFHLVVPAAMQVGEAHNICNKIENVLEAEFDNARVIIHVEPENEAKLPPGTTAV
PFI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaatactacaacaatagagatacaaagattaaccatatggtctattgtcgtggcttgt
attgtttctgctctcagatattgggcatattacatcacgggttcagttgcgctttattct
gatgcattggaatcaattgttaatgtgctttccgcgttagcagcgtggtgggctgttaaa
gtgagtacgaagccggctgatcaagatcatccttttgggcatcataaggcagaatatttt
tctgctatccttgaaggtgtgttcattattatcgcagcaattgtgattttgaaagaaacg
tgggcggctttttctactgttagaccgttgcagcagcctggaacgtggattgctattcat
tttgtagcaagtattattaattatttgtggggagcgattctcatccggcaggggaaaatt
taccgttcgccagctcttaaagctgacggcgtgcatttaatgacagatgtctttacttca
ttgggcattttagttggattgctagttgcttttttgagtggatgggctgttttagatccg
attttggcggtaatagttgcagttcacatccttttacaaggctggaaagtggtgaagaat
gctgctcaagggttaatggatgcaggagttgaattaagcgaaaccgtccgaattcgtgat
cttatttcgaccaatgcgtgcggcgcaattgaggtgcatgatttacggacgcgtgttgct
gggagggcgacctttatagaatttcacttagttgtgccggcagcaatgcaggtaggggaa
gcacacaacatctgtaataaaattgaaaatgtcctcgaagcggaatttgataatgcgcgt
gttattatccacgtagaacctgaaaatgaagctaagttgcctcctggcacaacggctgtc
ccttttatataa

DBGET integrated database retrieval system