KEGG   Bartonella australis: BAnh1_09020Help
Entry
BAnh1_09020       CDS       T02469                                 

Definition
(GenBank) hypothetical protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1153 HTH_28 HTH_29
Motif
Other DBs
NCBI-ProteinID: AGF74775
UniProt: M1P4J2
Position
1141629..1141904
Genome map
AA seq 91 aa AA seqDB search
MTNLMKTQTKYVIGPDGGPLTIADLPPITTKRWVIRRKAEVVAAVKGGLLSLDEACQRYT
LTLEEFLSWQSLVNEHGLAGLRTTKIQHYRH
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgactaatttgatgaaaacacaaacaaaatatgttattggtccagacggcggtccactc
acaatcgccgatttaccgccaataacgacaaaacgctgggttatccgccgcaaagctgaa
gttgttgccgccgttaaaggtggattattaagtctcgatgaagcgtgtcaacgctacact
ttgaccttggaagaatttctttcatggcaaagtttagttaatgaacatggtttagctgga
ctacggacgacgaaaatccaacattacaggcattga

DBGET integrated database retrieval system