KEGG   Bartonella australis: BAnh1_09030Help
Entry
BAnh1_09030       CDS       T02469                                 

Definition
(GenBank) hypothetical protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliJ CEP209_CC5 CENP-F_leu_zip
Motif
Other DBs
NCBI-ProteinID: AGF74776
UniProt: M1PDU8
Position
complement(1142032..1142418)
Genome map
AA seq 128 aa AA seqDB search
MKARENTVRLKRFQAREKRREIAQLEMMIAEFARMVSELEVQIVHEERKSGNNDIHHFAY
SAFARAARKRCDNLTDSLRDLRLRKTNAEIVLHEIDSELQHMQTLEMREDKAVAGDNDIS
VQSCSMIG
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcacgagaaaatacagtgcggttaaaaaggtttcaagcgcgcgaaaagcgtcgc
gaaattgcacaacttgagatgatgattgcagaatttgcgcgaatggtatcagagttagaa
gtgcaaattgttcatgaggaacgtaaatccggaaacaatgatattcaccattttgcgtat
tcagctttcgcgcgcgctgcgcggaaaaggtgtgataatctcacagactcacttcgtgat
ttgcggcttcgaaaaacaaatgctgagatcgttttacatgaaattgactcagagcttcaa
catatgcaaactcttgaaatgcgggaagataaggctgtcgcgggcgataacgatatttcc
gtccaatcttgctctatgattgggtga

DBGET integrated database retrieval system