KEGG   Bartonella australis: BAnh1_09090Help
Entry
BAnh1_09090       CDS       T02469                                 

Definition
(GenBank) oxidoreductase
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA F420_oxidored AlaDh_PNT_C GFO_IDH_MocA_C
Motif
Other DBs
NCBI-ProteinID: AGF74782
UniProt: M1NZC1
Position
complement(1147970..1148938)
Genome map
AA seq 322 aa AA seqDB search
MVPRIAVLGCGYWGGNHIRTLQSLGALAAVSDVDVDRAREVARTHDVEVIAPDNLFTRVD
IDALVLALPPQFHTENALRAIKNGKDVLVEKPIALNVADAEHQVRVAGEYGRIFMVGHVL
RFHPAFEKVCELVAKGELGDVRYIYSHRLGFGKFHAESDALWDLAPHDLSMILALTGCEP
SGVRGEGSSVIDQLSDFAHIHMTFPNGIHSHLFVSRLSLYRERRLTVVGTKAVLVFDDME
PWSRKLAFHRFAVWQENQEWIFNAGESRYIGVGESLPLTNELQHFLHCIETRQSPCTNGD
DAVAVLRILTAASTNHHDKKDE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggtgccacgtatagcggttttagggtgtggttattggggagggaatcacatacgaacc
ctccaaagtcttggagctttagcggcagtttctgacgttgatgtagatcgcgctagggag
gttgcacgtacgcacgatgtcgaagttattgcgcccgacaatctttttactcgcgtagat
attgatgcattggtattagcgttacctccgcaatttcacacagaaaatgcgctgcgtgct
attaaaaacggtaaagatgttttagtggaaaaaccgatagctttgaacgtagctgatgcc
gagcatcaagttcgagttgctggtgaatacgggcggatttttatggtggggcacgttttg
cggttccatcctgcttttgaaaaagtatgtgagttggtggcaaaaggcgaattaggtgat
gtgcgttatatttattctcatcggttaggattcggaaaatttcatgcagaaagcgatgct
ttatgggatcttgctcctcatgatctttcaatgattttagctttaacgggatgtgagcct
tccggagtccgcggagaggggtcctcggtgattgatcagctttctgattttgcgcatatt
catatgacatttccgaatggtatacacagccatctttttgtttcacgtctcagtctgtac
cgtgaaaggcgtttgacagttgtcggcacaaaagctgtgcttgtatttgatgatatggaa
ccgtggagtcgcaaattggcgtttcatcgcttcgctgtttggcaggagaatcaagaatgg
atatttaacgctggtgagtcccgttatatcggcgttggtgaaagtttaccgcttaccaat
gaattacagcattttcttcattgtattgagacgcgtcaatcgccttgtacaaatggcgat
gatgccgttgctgttttacggattttaactgctgctagtactaatcatcatgacaaaaaa
gatgagtag

DBGET integrated database retrieval system