KEGG   Bartonella australis: BAnh1_09110Help
Entry
BAnh1_09110       CDS       T02469                                 

Gene name
dppD
Definition
(GenBank) dipeptide ABC transporter, ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
baus  Bartonella australis
Pathway
baus02024  Quorum sensing
Module
baus_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:baus00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BAnh1_09110 (dppD)
Transporters [BR:baus02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    BAnh1_09110 (dppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N oligo_HPY AAA_21 AAA_22 AAA_29 DUF87 GTP_EFTU PRK AAA_18 MMR_HSR1 AAA_16 AAA_24 AIG1 AAA_23
Motif
Other DBs
NCBI-ProteinID: AGF74784
UniProt: M1N4F7
Position
complement(1150676..1151560)
Genome map
AA seq 294 aa AA seqDB search
MDKKLLEIKDLRISFPGARGLSEVVRGINFSVGKEKIGIVGESGSGKSTTGRAILKLNPK
SAVIKAKKMRFGDIDLLAADETQMRTIRGRRISMILQDPKYSLNPLIRIGEQIMEAYRVH
YKVSKKDARERTISMLESVHIRDPEHVMRLFPHEISGGMGQRVMIAMMLIPKPDLIIADE
PTSALDVTVRRQVLTVLDELVIKSGTGLIFISHDLNMIADFCDRVLVMYAGRILEELPAC
DLSRACHPYTKALLASLPRLDKPVDVLAVPERDPDWLNSPTIVNGVAGDSHGQL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaattattagaaataaaagatttacgaatttcttttcctggtgcgcgcggc
ctatcagaggtcgtgcgtggtattaatttttctgtcggaaaagaaaaaattggaattgtc
ggagaatcgggatccggaaagtcaacaaccgggcgcgccattttgaaattaaacccaaaa
tcggcagtcatcaaagccaaaaaaatgcgctttggggatatagatttgttagctgcggat
gaaactcagatgcgcactattcgaggaaggcgtatttcgatgattttacaggatccaaaa
tattctcttaatccattaatacggattggggagcagatcatggaggcctaccgtgttcat
tacaaggtttcaaaaaaagacgcacgggaaagaacaatttctatgctggaatctgttcat
attcgcgatcctgaacatgtcatgcggttgttccctcacgaaatatcaggtggaatggga
cagcgggtcatgatagctatgatgcttattcctaaacctgatttaattatcgcagatgag
ccgacgtctgcgcttgacgttacagtgagacgtcaagttttaacggttttggatgagctt
gtgataaaatctggcacaggacttatttttatcagtcatgatttgaatatgattgccgat
ttttgtgatcgtgttttagtaatgtatgctggccgtatattagaagaattacctgcatgc
gatttatctcgcgcatgccatccctatactaaggctttactggctagtttaccgcgtctt
gataagcccgttgatgttttagctgttcctgaaagggatcctgattggttgaatagtcct
acaattgttaatggtgttgcaggagatagccatggccaattataa

DBGET integrated database retrieval system