KEGG   Bartonella australis: BAnh1_09180Help
Entry
BAnh1_09180       CDS       T02469                                 

Gene name
xseA
Definition
(GenBank) exodeoxyribonuclease VII large subunit
  KO
K03601  
exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
baus  Bartonella australis
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:baus00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    BAnh1_09180 (xseA)
Enzymes [BR:baus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     BAnh1_09180 (xseA)
DNA repair and recombination proteins [BR:baus03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA exonucleases
     BAnh1_09180 (xseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1161052..1162482)
Genome map
AA seq 476 aa AA seqDB search
MVDLFIERPAATNVAEFSVSEIATALKHVVEEKFGYVRVRGEISGYRGTHASGHAYFALK
DDKARLEAVIWRGTMAKLKFPPEEGMEVVAVGKLTTYPGSSKYQIVVEALEPMGIGALMT
LLENRKKKLADEGLFDETKKKPLPYMPKIIGVVTSPTGAVIRDIIHRISDRFPLHILVWP
VRVQGEASGREVTAAIKGFNALPSGSVLVRPDLIIVARGGGSLEDLWGFNDEAVVRAVSA
SNIPVISAVGHETDWTLIDFVADWRAPTPTGAAEIAVPVKLDLEALLASLNARLRVGLTR
YFDFHRQKLRAIVRGLPTADQLFALPRRGFDEISSRLVRALRVSYDKKHFYFCALSMRLS
SRLLNTEKARHNTEEYAARLHRAFLRNVEKYRARAEMAFRLLKSTSYQNVLERGFVLALG
KGDKPIKRLAQFSETDEINLRFFDGEVSVSACDRTLEKKSRLKKIKSQQDDQGTLF
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggtagatttgtttattgaaagaccagcggcaacgaatgtagcggaatttagtgtctct
gaaatagcgactgctttaaagcatgttgttgaggaaaagtttggttatgtacgagtacgc
ggggaaatatcgggttatcgcggcacacacgcttcaggtcatgcttattttgctttgaaa
gatgataaggcgcgattagaggctgtcatctggcgcggtactatggcaaagcttaaattc
cctcctgaagaagggatggaagtggttgccgtcggtaagcttaccacttatccaggttca
tcgaaatatcagattgttgttgaagctcttgagccgatgggtatcggggctttgatgaca
cttttagaaaatcgcaagaaaaaactcgctgatgaaggcttgtttgatgaaaccaagaaa
aagcctttgccctatatgcccaaaattataggagttgttacatctccgacaggagctgtt
attcgcgatatcattcaccgtatatcagatcgttttcctttgcatattctggtttggcct
gtgcgagttcagggcgaagcaagcggacgagaagtgacggccgctattaaagggtttaat
gcactgccttcaggtagtgttttagtgaggcctgatcttattattgtagcacgcgggggg
ggcagtttggaagatctgtgggggtttaatgatgaggcggtcgttcgcgctgttagtgcg
tctaatatcccggttatttccgcagttggccatgaaacggattggactctgattgacttt
gttgcggattggcgggcaccaactcctacgggagcagcggaaatagctgtccccgtcaag
cttgatcttgaagcgctgttggcctcgcttaacgcgcgccttcgtgtagggcttacacgt
tattttgattttcaccgacaaaaattacgcgctattgtacgaggtcttcctactgctgat
cagctatttgccttaccgaggcgtggttttgatgagatttcaagccggttagtgcgtgct
ctccgcgtgagttacgataaaaaacatttctatttttgtgcactaagtatgaggctttct
tcgcgcttattgaatactgaaaaagcacggcacaatacggaagaatacgcggcacgcctt
catcgcgcttttctacggaatgtcgaaaaataccgcgctcgggctgagatggcgtttaga
cttttgaagagcacttcttaccagaatgttttagagcgcggttttgttttggctttagga
aaaggcgataagccgattaagcggttggcgcagttctctgaaacagacgaaataaatttg
cgtttttttgatggtgaggtcagtgtttcagcgtgtgatcgtaccctcgaaaaaaaatca
agactgaaaaaaataaaatcgcagcaagatgatcaaggaacccttttttga

DBGET integrated database retrieval system