KEGG   Bartonella australis: BAnh1_09200Help
Entry
BAnh1_09200       CDS       T02469                                 

Definition
(GenBank) putative membrane protein
  KO
K07090  uncharacterized protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE DUF3959
Motif
Other DBs
NCBI-ProteinID: AGF74793
UniProt: M1NU05
Position
complement(1164027..1164947)
Genome map
AA seq 306 aa AA seqDB search
MSVYLPIAEMSLDALVLISMGAVVGFISGLFGVGGGFLITPLLIFYNIPPAIAVGTGANQ
MIASSVTGAITHFKRRTLDIKIGIFLVLGGGVGSVTGIQIFSVLKRWGQLDFVISLLYIV
LLGSVGSLMIVESLCAIMRRSGGQKIGVRRLSRHNWIHRLPFKMRFRASMICVSVIPVLV
IGFITGLLSSIMGIGGGFITVPALIYLLHVPTNVVIGTSLFQITFVSAFTTVLQSVSHQS
VDIVLAFLLMLGGGVGAQYGTWAGRKLKAEQLRMALAFLVLIVCTRLAFQLFIRPDNLFS
LTILMR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtttatttaccgattgctgaaatgtcgcttgatgcgctggtcttaatcagcatg
ggggcggttgttggctttatttcaggtctttttggggttggtgggggttttttaataaca
cctttattgatcttctataatattcctcctgccatcgctgttgggacgggggctaatcag
atgattgcatcgtccgtgacaggggcgattacgcattttaagaggcgaactcttgatatc
aagattggtattttcttagtccttggggggggagttggctctgttacggggatccagatt
ttttctgttcttaaaagatgggggcagttagattttgtgatttcgcttctttacatagtt
cttcttggtagcgtagggagtttgatgattgttgaaagtctgtgtgctataatgcgacga
agcgggggacaaaaaatcggtgttcgtcgtcttagccgacataattggattcatcggctg
ccttttaaaatgcgttttcgggcgtcaatgatctgcgtaagtgtgatcccggttttagtg
attggctttattactgggttgttatcttctattatgggcattggagggggctttattaca
gtgccggcgctgatttatcttttgcatgtcccgaccaatgtagtaataggaacgtcgctt
tttcagattacatttgtatcggcttttaccactgtcttacaaagtgtgagtcatcagtct
gttgatattgttctagccttcttgctcatgcttggtggcggcgttggcgcgcaatatggg
acgtgggctgggagaaaattaaaggccgaacaattgcgtatggcgctcgcgtttcttgtg
ttaattgtgtgtacgcgtttagctttccaattatttatacgccctgataaccttttttct
ctgaccatccttatgagataa

DBGET integrated database retrieval system