KEGG   Bartonella australis: BAnh1_09240Help
Entry
BAnh1_09240       CDS       T02469                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
baus  Bartonella australis
Pathway
baus00330  Arginine and proline metabolism
baus01100  Metabolic pathways
baus01110  Biosynthesis of secondary metabolites
baus01130  Biosynthesis of antibiotics
baus01230  Biosynthesis of amino acids
Module
baus_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:baus00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BAnh1_09240 (proC)
Enzymes [BR:baus01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     BAnh1_09240 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_oxidored P5CR_dimer NAD_binding_2 Semialdhyde_dh Shikimate_DH 2-Hacid_dh_C GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AGF74797
UniProt: M1NZD6
Position
complement(1169990..1170793)
Genome map
AA seq 267 aa AA seqDB search
MKIGFLGTGKISASMVDGLMAGTFDVSSIIISPRNAHVAARLAHNYDKVTIAESNQALLD
SSDYVFICLPNQSAENILRSLYFPPEQLVISVLATAKVAEVEEWISHKVYRAVPLPFVAE
CKNLTPIYPDHPFLRTMFDALGGTLVLQEEDQFNLFMTAGSLMGVYFNFMETAHQWLVNQ
GLKKHQSADFFVMMFGNLADEMRKMAKNNPREPVDFAWLEREFSTKGGTNELLSNCFSRQ
GGQMALKTALENALQKISTCSAIKEKV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggttttttgggaacaggtaaaattagcgcttcaatggttgatgggttaatg
gctggtacttttgatgtatcttcgattataatttcaccacgtaatgcacacgtagcggca
cgtcttgcgcacaattatgataaggtcaccatcgctgaaagtaaccaagcattgctggat
tctagtgattatgtttttatttgtttacctaaccaaagtgcggaaaatatattgcgttct
ctttatttccctccagagcaacttgtaatttctgttcttgcgacggcaaaagtggcggaa
gttgaagaatggataagccataaggtttatcgtgctgtcccacttccttttgtggcagaa
tgcaaaaatttgacgccaatctaccctgatcacccattcttgcgcactatgtttgatgca
ctaggaggaacattggttcttcaggaggaagaccagtttaacctttttatgacggctggt
tcattaatgggtgtttattttaattttatggagacggcgcatcagtggttagtaaatcag
ggactcaagaaacaccaatctgcggatttttttgtaatgatgtttggaaatctcgccgat
gaaatgcgcaagatggcgaaaaataatcccagagaacctgtcgattttgcgtggcttgag
agagaattttcgacaaaagggggaacaaatgaacttttatcaaattgcttttcccgtcaa
ggtgggcaaatggctctaaaaacggctcttgaaaacgctttgcagaaaatttctacttgc
tcggcaattaaggaaaaggtttga

DBGET integrated database retrieval system