KEGG   Bartonella australis: BAnh1_09260Help
Entry
BAnh1_09260       CDS       T02469                                 

Definition
(GenBank) tetrapyrrole methylase family protein
  KO
K07056  16S rRNA (cytidine1402-2'-O)-methyltransferase [EC:2.1.1.198]
Organism
baus  Bartonella australis
Brite
Enzymes [BR:baus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.198  16S rRNA (cytidine1402-2'-O)-methyltransferase
     BAnh1_09260
Ribosome biogenesis [BR:baus03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    BAnh1_09260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase DnaG_DnaB_bind
Motif
Other DBs
NCBI-ProteinID: AGF74799
UniProt: M1N4H4
Position
complement(1171630..1172517)
Genome map
AA seq 295 aa AA seqDB search
MSENTYCIGVHAYCAPVIEPALYLVATPIGNLDDITIRALQILAGVDILACEDTRVVRIL
LERYGIEKKTFLYHEHNVQKAGPKLLEALAKNKTVALVSDAGTPLISDPGFRLVGEARKA
GHKIVPIPGASALLAAIVATGLPTDSFFFAGFLSAKKAQRQNRLEQLKTIPATLVFYESP
HRLVESLQDISAIFGTDRPAAICRELTKKFETVDVSNLENLVEQYGKKERIRGEIVVLVG
GATASAKAMSTQEIDEILLQLADKHPAAKAAALTAKKTGLKKQELFRRLTSLKGS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaacacgtattgtataggtgttcacgcctattgtgcaccagtgatagaacca
gcgctttatttggtggcaacacctatcgggaatctcgacgatataaccattcgcgcctta
caaatcctcgcaggggtcgatatcttagcttgcgaagatactcgagtcgtgcgtatttta
ttagagcgttatgggatcgagaaaaaaacttttctttatcatgaacataatgtgcaaaaa
gcggggccaaaattattagaagctttggcaaaaaataaaacggtagctcttgtgtcagat
gcaggcactccgcttatttctgatccaggatttagattagtgggggaagcgcgcaaagcg
ggtcataaaattgttcctattccgggtgcttcggcccttttagcggctattgtagccaca
ggtctccccacggatagttttttctttgcaggttttttgagtgcaaagaaggcgcagcgc
caaaatcgattagagcaattaaaaactattcccgcgactttggttttttacgagtcgccc
caccgtcttgtagagtctttgcaggatatatctgctatttttgggactgaccggccagca
gcaatatgtcgcgaattaacgaaaaaatttgagacagtggacgtctccaatttagaaaat
ttggttgagcaatatggaaaaaaagagcgcatacgtggagagattgtcgtgctggtcggg
ggagcaacagcttctgccaaggcgatgagtactcaggaaattgatgagattcttctacaa
ttggcagacaaacaccctgctgctaaggcagccgctttaacagcaaaaaagaccggtttg
aaaaaacaggaacttttcagacgattgacctctttaaaggggtcataa

DBGET integrated database retrieval system