KEGG   Bartonella australis: BAnh1_09270Help
Entry
BAnh1_09270       CDS       T02469                                 

Gene name
mrp
Definition
(GenBank) ATP-binding protein involved in chromosome partitioning
  KO
K03593  ATP-binding protein involved in chromosome partitioning
Organism
baus  Bartonella australis
Brite
Chromosome [BR:baus03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BAnh1_09270 (mrp)
Mitochondrial biogenesis [BR:baus03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    BAnh1_09270 (mrp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParA CbiA FeS_assembly_P AAA_31 MipZ Fer4_NifH ArsA_ATPase AAA_25 VirC1
Motif
Other DBs
NCBI-ProteinID: AGF74800
UniProt: M1P4L6
Position
complement(1173315..1174409)
Genome map
AA seq 364 aa AA seqDB search
MGLITRDAICKELQKIKGPNFESDIVSLGLLSEILIADGKVFFSITVPDERVQEWESLRR
AAEKAVCAMDGVETVIVTLTAERKPVAHTQTHKDRKFFASKRKASALPLKMPIKGVRHVI
AVASGKGGVGKSTMAMNIALALRGAGFKTGLMDADIYGPSLPRLTGLVNQKPQLADGKKL
QPLEKFGLKLMSIGFLVEEEQPVVWRGPMVMAAVKQLLRDVLWDPLDVLVVDMPPGTGDA
QLTLVQQVPLTGALIISTPQDLALVDARKAIEMFMKVDTPILGLVENMSYFIAPDTRKRY
DIFGSGGARAEAESRGIPFLAEVPLDAILRSSSDDGVPVFFADPDGKYAELYRTMINQIK
DKLS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcttatcacgcgcgatgctatctgcaaagagctacagaaaattaaaggaccgaat
tttgagagtgatattgtatcgcttgggcttctttcagaaatactaattgctgacggcaaa
gtttttttttccattacggttcctgacgagcgcgtgcaggagtgggagtcattgcgccgt
gctgctgaaaaggcggtgtgcgctatggacggggttgaaaccgttattgttacactcacg
gcagaaagaaaaccggtggcacacactcaaacgcacaaagataggaaattttttgcgtca
aaacgtaaagcaagcgcgcttcctttgaaaatgccgataaaaggagtacgacatgtcata
gcagttgcttctggaaagggaggagtcgggaaatctactatggcgatgaatatcgcattg
gctttgcgtggtgcgggtttcaaaacgggtttgatggacgcggatatttatggtccttct
ctgccacgtttgacagggctcgttaatcaaaaaccacagctcgctgatggtaaaaagctg
cagcctctcgaaaaatttggccttaaattaatgtcaataggctttctcgttgaagaagaa
cagccagttgtatggcgtggtcccatggttatggcggctgtgaagcaattgctacgggat
gttttatgggatcccctcgatgttttggtagtcgatatgccgccgggaacaggggatgcg
caattaactcttgttcagcaggtaccgctaacaggtgcgcttattatttctactccgcag
gatcttgctttggttgatgcgcgtaaagcgatagaaatgtttatgaaagttgacacgcct
attttggggctcgttgagaatatgagttattttatcgcgccggacacgcgaaaacgctac
gatatctttggttctggtggtgcgcgggcggaagcggagagccggggcattcctttctta
gctgaagttccgcttgatgcaattttaaggtcttcttcagacgatggtgtgccggtcttt
tttgctgaccctgatggaaagtatgcagagctttatcgtactatgatcaatcagatcaaa
gataaactttcttaa

DBGET integrated database retrieval system