KEGG   Bartonella australis: BAnh1_09300Help
Entry
BAnh1_09300       CDS       T02469                                 

Gene name
engB
Definition
(GenBank) GTPase EngB
  KO
K03978  
GTP-binding protein
Organism
baus  Bartonella australis
Brite
Chromosome [BR:baus03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BAnh1_09300 (engB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1177369..1178016
Genome map
AA seq 215 aa AA seqDB search
MTKCLISSGFFPRNWVFIRGVPAVHFLPPEGPPEIAFAGRSNVGKSSLINALVQQKGLAR
TSNTPGRTQQLNYFVPDGFSGQPGDLPPLALVDMPGYGFAEAPKNLVDAWTHLIFNYLQG
RTTLKRVYVLIDSRHGIKKNDIDVLDLLDKAAVSYQIIFTKSDKIKSSVLENLIITTKTK
FLKRPAAYPELLVTSSEKALGLEELRSAILGAIAR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaatgtcttatctcttccggattttttccccgtaattgggtttttatccgtggt
gtacccgcagtgcacttcctcccgcccgaaggcccgccagaaatcgcttttgcaggacgt
tccaatgttgggaaatcttctttaatcaatgcgcttgtccaacaaaaaggcttagcgcgc
acctcgaatacaccaggacgcactcagcaactcaattattttgtacctgacggcttcagc
ggccaaccaggagacctccctcccctggcgctcgtagatatgccaggttacggttttgca
gaagcccccaaaaacctcgttgatgcgtggacacatctgatttttaattatttgcaaggt
cgtacaacacttaaacgtgtttatgttttaattgattcacgtcatggaattaaaaaaaat
gacatagatgtacttgaccttcttgataaagcagcagtttcgtaccaaattattttcacc
aaaagtgataaaattaaatctagtgttctcgagaaccttataataaccacaaaaacgaag
tttcttaagcgtcccgcggcttatccggagcttttagtgacttcttcagaaaaagcttta
ggcttagaagaattgcgttctgctattttgggagctatcgcgcggtaa

DBGET integrated database retrieval system