KEGG   Bartonella australis: BAnh1_09360Help
Entry
BAnh1_09360       CDS       T02469                                 

Definition
(GenBank) transcriptional regulator, XRE family protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1182136..1182348)
Genome map
AA seq 70 aa AA seqDB search
MDETVQRLGSLVRQTRKMQGLTQKQLAGVSGVGVRFIRELEQGKESCHIGKVLVIIQMLG
LTVQVDDEIL
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atggacgagacagttcaaagattaggaagccttgttcggcaaacacgaaaaatgcaaggg
ctaacgcaaaagcaactggcgggtgtaagtggtgttggggtgcgttttattcgcgaatta
gaacaagggaaagaatcttgccatatcggtaaagttttagtgattattcagatgctgggc
ctcacggttcaagtcgatgatgagatattgtga

DBGET integrated database retrieval system