KEGG   Bartonella australis: BAnh1_09410Help
Entry
BAnh1_09410       CDS       T02469                                 

Definition
(GenBank) hypothetical protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1186827..1187045)
Genome map
AA seq 72 aa AA seqDB search
MVKNYLLMMGAALAAFFMAFFKIFKLGREKERDRQSQADLKAAQIRLEVDHEIDQMDDNS
VRSNLLKWVRDK
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaaactatctgctgatgatgggtgcggcattagccgctttttttatggccttc
ttcaagatctttaagcttggacgggagaaagagcgggatagacaaagccaggctgattta
aaggccgcgcaaataagactggaggttgatcatgaaattgatcaaatggacgataatagc
gtgcgctctaatctgcttaaatgggtgcgcgacaaatag

DBGET integrated database retrieval system