KEGG   Bartonella australis: BAnh1_09420Help
Entry
BAnh1_09420       CDS       T02469                                 

Definition
(GenBank) phage related lysozyme
  KO
K01185  
lysozyme [EC:3.2.1.17]
Organism
baus  Bartonella australis
Brite
Enzymes [BR:baus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     BAnh1_09420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1187045..1187722)
Genome map
AA seq 225 aa AA seqDB search
MRKINKDGIEALKRWEGLRLESYQDIGGVWTIGYGHTENVKAGETITAKQADVLLKKDLI
GFERAVHEAVKVDLNDNQFAALVSFAFNIGVAAFKESTLVKKLNQGDYDCVPGQLNRWVY
CSGKRSQGLINRRAAEIGLWSKGSFIASQCVECAEPERQRFHKTGEGKSAIVAGLGLLGS
TCSEAAHQLEPFIGNLDIMRYAFLALTLAGVGFGLWATMKRLKEA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaatcaataaagacggcattgaagctctcaagaggtgggaaggtttacggctt
gaatcctaccaggatattggaggagtttggaccattggttacggccatacagagaatgtt
aaagcgggggagacgatcacggctaagcaagctgatgtgcttttaaaaaaggatctcata
ggctttgagcgggctgttcatgaagcagtcaaggtggacttgaatgacaaccagtttgcc
gcccttgtttcctttgcgttcaatattggtgtagctgctttcaaagaatctaccctggtt
aagaagctcaatcaaggtgattacgactgtgtgcccggacagctcaatcgttgggtatat
tgctctggaaaaagatcgcaaggcttaatcaatcgccgtgctgcggaaataggtttgtgg
tctaagggctcctttatcgcatcacaatgtgttgagtgtgcagaacctgaacgtcaacgt
ttccataagacaggtgaggggaaatcggccatcgttgcgggtttagggcttttgggatct
acatgttctgaggcagctcaccagctagagccttttatcggtaatctggatataatgcgc
tatgcgtttttagccttgacgcttgcaggtgttgggttcggattgtgggccacgatgaag
cgcttgaaggaagcataa

DBGET integrated database retrieval system