KEGG   Bartonella australis: BAnh1_09460Help
Entry
BAnh1_09460       CDS       T02469                                 

Definition
(GenBank) phage tail protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhageMin_Tail
Motif
Other DBs
NCBI-ProteinID: AGF74818
UniProt: M1NU30
Position
complement(1189689..1191572)
Genome map
AA seq 627 aa AA seqDB search
MSKKVADAKVKLSLEDGLTAPIKRLQKEFDVLSKKISHKLGVHRFSAAVKNMTKSLQGVQ
GALSTVAKRASILSGALGLAGGGLVASLSAITMKTIHMGDSLHHASRHLGMSVAALQLWS
DAADRSGYSGELFQQSLATLNRRSAQAFSGQRRGVMGFKALGISVKNASGQLKSNSALLE
EIIDKMSKMKNQAQRQHIAALLFGGDGKEMAAMLSQGMEPFKELFAKARKGKWLIGADVA
HYAADLSDKLGAFKKKIGGVANFIGSRFMPVLNDMIDIFSKLIDENRDLIQTTASEWAKT
LKQFMLDLLNPASDLRRGISDITESIKAWFRWMEPLIGEITLFKVGLVALSAFIVGPLIA
SLIVVGEAVVSLGVAIMTTPIGWIIGGIALLVGAGYLLYKNWDRVAGFIGKLWDSFVGLC
SNVFDELITLFKDFSPLYWIAKKINALVKWLLEHNLIEAGSNLIAGLWEGMKSKWNALCN
WFSDSVNKLTSWMPNWIKEKLGFNVTINKTSTETLKTFTDETNARAKRMVDRAVVTSTPS
GKSDNGFHPGEVKTEYGEATNVKVGSFKAPEPIRVHRSAEIDASITITNLNISGGNGSTE
EIHAAVNRAFERHAKQQRLAIASSLSD
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaagttgcagatgcaaaagtaaaactgtctttagaagacgggctcactgca
cctatcaagcgtcttcaaaaggaatttgatgtcctttcaaagaagatatcgcataaattg
ggtgttcaccgtttttctgctgcggtaaaaaatatgaccaaaagtctgcaaggtgttcaa
ggtgccctcagcacggtggcaaaacgtgcttcgattttgtccggagctttagggctggct
ggtggtggccttgtggcaagcttaagtgccattaccatgaaaaccatacatatgggggat
agccttcatcacgcgtcgcggcacctaggtatgagtgtcgcagcgcttcaattatggagt
gatgctgctgatcgttcaggatattccggtgaactctttcagcagtccttggcaactttg
aataggcgttctgcacaagctttctctggacaaagaagaggtgttatggggtttaaggca
cttggcatttctgtcaaaaatgcctcgggacagctcaaatcaaactcagccttgttggaa
gaaattattgacaagatgagtaaaatgaaaaatcaagcacaaaggcaacacatcgcagct
ctactatttggtggtgatggcaaagaaatggctgctatgctctcgcaaggcatggagccc
ttcaaagaactattcgcgaaggcgcgcaaaggaaagtggctaataggtgcagatgtcgcg
cactatgcagcagatttaagtgataagcttggggcttttaagaaaaaaataggtggtgtc
gctaatttcattggttcacgtttcatgcccgtgctcaatgacatgattgatatcttttca
aaattgattgatgaaaaccgcgatctcattcaaacaaccgcttctgaatgggcaaaaacc
ctgaagcaatttatgctggatttgcttaatcccgcttctgatttgagaaggggtatcagc
gatatcacggaaagcattaaagcctggtttcggtggatggagccactgatcggtgaaata
acactctttaaggttggtctcgttgcgcttagcgctttcattgtgggcccgctcattgcg
tctttaattgtggttggggaagcagtcgtttcgctaggtgtcgctattatgaccacccct
atcggttggataattgggggcattgcattgcttgtgggggctgggtatctgctctacaaa
aactgggatagggtcgcaggctttataggaaaattatgggattcttttgtcggcttatgc
agtaacgtttttgatgaattaataactctctttaaagatttttcaccactctattggata
gccaaaaaaatcaacgcattggttaagtggttgctggagcacaatttaatcgaagcaggc
tctaatctcattgcgggattatgggaaggcatgaaaagcaaatggaatgctctgtgcaat
tggttcagcgatagcgttaacaaattaacgagttggatgcccaattggataaaagaaaag
ttaggttttaacgtcacgatcaataaaacttcaacggaaactctgaaaaccttcaccgat
gaaactaatgcgcgcgcaaaaagaatggttgatagggcagttgttacgagcactccgtct
ggaaaaagcgataatggtttccatccaggtgaagtcaaaacagaatacggggaggcaaca
aatgtaaaagttggatcctttaaggctcctgaacctattagggtccatagatcagcagaa
atagacgcttctataaccattacaaatttaaatatttcggggggaaatggttccacggaa
gaaatccacgcggcggttaaccgagcatttgaacgccatgctaagcaacaacgcttagct
atagcctccagcctttcggactaa

DBGET integrated database retrieval system