KEGG   Bartonella australis: BAnh1_09490Help
Entry
BAnh1_09490       CDS       T02469                                 

Gene name
gpFI
Definition
(GenBank) phage tail sheath protein FI
  KO
K06907  
uncharacterized protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1192475..1193866)
Genome map
AA seq 463 aa AA seqDB search
MATDFLHGVEVVEVDDATRPLRAVQSAVIGIVGTAPDADELAFPLNTPVLISGSLSQAAK
LDKTGKRRGTLPNALDLIFKQVGAVVVVVRVKEGDDESATLTNILGGVDANGSYEGVHAL
IGAQSLVGQTPRILIAPGFTHKRPLSINKIDVTNQGSGYTQATVKIAGDIEAEAILTDGK
VTSIVIKKNSFDYQTAPIVTIEGDGTGATAKAETSITSNPVAAELIGIAERLRAIVVIDA
PNTTDEAALAAAQDFDSKRVILIDPFVKVNRNGKILEEPASAAVAGVIAKTDAANGFWHS
PSNKVINGIVGIARPIDFSIGDSSSRANLLNEQNITTIIRENGYRLWGNRTLSSDAKFAF
LSVVRTADMINDAVLRGHLWAVDRNIKKTYMNDVSESVNAYLRDLKAQGAILGGHCAPDP
ELNTASALESGKVYFNVEFTPTTPAEHITFRSQIVSDYLEEIF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagattttttacacggcgttgaagtcgtcgaggttgatgatgccacgcgtccc
cttcgcgcggttcaatcagcggttatcggcattgtcggcacagcaccggatgcagacgag
ctagcctttcctctcaacacaccggttttgatatcaggttctctttcacaagcagccaaa
cttgataaaacaggcaagagacgcggcactttgcccaatgctcttgacctgattttcaag
caagtgggagctgttgttgttgtcgtacgggtaaaggaaggcgacgatgagagcgcaaca
ttgacgaatattctgggtggtgtggacgcaaatggttcttatgaaggcgttcacgctttg
attggagcacaatcccttgtggggcaaacaccacgcatcctgatcgctccaggctttacc
cataagcgtcctcttagcattaacaagattgatgttacaaaccaagggagtggttacacc
caggcgacagttaagattgccggtgatatagaagcagaagcgatccttacggatgggaaa
gtgacgtctatcgtcataaagaaaaatagctttgattatcaaactgctccaattgtaacc
attgaaggtgacgggactggtgctaccgccaaggctgaaaccagtataacgtctaatcct
gtggcagcagaactcatcggtattgcagaacgtctgcgtgctattgtggtgattgatgca
ccaaacacgacagatgaagcagctcttgctgcggcacaagattttgattcaaaacgtgtc
attctcattgatccctttgtgaaggttaatcgaaatggcaaaatcttagaagaaccggcg
agtgcagcagttgcaggtgtcattgccaaaactgacgctgcaaatggtttttggcattcc
ccttcaaataaagtaatcaatgggattgttggtatagcacgcccgattgatttttctatc
ggtgacagctctagccgcgccaatcttcttaacgaacaaaatatcacgactattatccgg
gaaaacggttatcgcctatggggcaaccgcacactttcaagtgacgcaaaatttgctttt
ttatcggtggtgagaactgcggatatgatcaatgatgccgttttacgcgggcatctatgg
gcagtcgatcgcaatatcaaaaaaacctacatgaacgatgtgagtgaaagcgtcaatgct
tacttacgcgatttaaaagcacaaggcgccattcttggtgggcattgcgctcccgatcca
gaactgaacacagctagcgctcttgaaagtggcaaagtctatttcaacgtggaattcaca
ccaacaacaccggcagaacatatcacattccgttcacaaatcgtcagtgattatttagag
gagatcttttaa

DBGET integrated database retrieval system