KEGG   Bartonella australis: BAnh1_09510Help
Entry
BAnh1_09510       CDS       T02469                                 

Gene name
higA
Definition
(GenBank) plasmid maintenance system killer protein
  KO
K07334  toxin HigB-1
Organism
baus  Bartonella australis
Brite
Prokaryotic defense system [BR:baus02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   HigB-HigA
    BAnh1_09510 (higA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HigB-like_toxin
Motif
Other DBs
NCBI-ProteinID: AGF74823
UniProt: M1NU35
Position
complement(1194473..1194748)
Genome map
AA seq 91 aa AA seqDB search
MIKTFKNKDLQSLWETGKSKIDSRLHKRIIRRLDTLEAASQVSDVNIPGYDFHMLRGFNP
ARYTIHVNGPWCITFEFIDGHAIHVDLEQYH
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaacatttaaaaataaagacttgcaatctctttgggagacaggaaagagcaag
attgatagtaggctccataagcgtatcattcgccgtcttgatactcttgaagccgcttct
caagtaagcgacgttaatataccgggctatgattttcatatgcttaggggatttaatcca
gctcgttatactatccacgtcaatggaccgtggtgcattacttttgaatttattgatggt
catgcaattcatgttgatttagagcaatatcattaa

DBGET integrated database retrieval system