KEGG   Bordetella avium: BAV0243Help
Entry
BAV0243           CDS       T00695                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bav  Bordetella avium
Pathway
bav00010  Glycolysis / Gluconeogenesis
bav00260  Glycine, serine and threonine metabolism
bav00680  Methane metabolism
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01120  Microbial metabolism in diverse environments
bav01130  Biosynthesis of antibiotics
bav01200  Carbon metabolism
bav01230  Biosynthesis of amino acids
Module
bav_M00002  Glycolysis, core module involving three-carbon compounds
bav_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAV0243 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BAV0243 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAV0243 (gpmA)
Enzymes [BR:bav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAV0243 (gpmA)
Membrane trafficking [BR:bav04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BAV0243 (gpmA)
Exosome [BR:bav04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAV0243 (gpmA)
  Exosomal proteins of melanoma cells
   BAV0243 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAJ47848
UniProt: Q2L0A6
Position
250052..250804
Genome map
AA seq 250 aa AA seqDB search
MYKLVLMRHGESQWNLENRFTGWTDVDLTEVGREQARRAGELLKREGYTFDLAYASVLKR
AIRTLWIALDAMDAMYTPVGLNWRLNERHYGQLQGLNKAETAAKYGDEQVLIWRRAYAIA
PEPLDIDDPRHPRFDSRYAKIPAEQLPATECLRDTVARVLPFWNESIAPAIRAGRRVLVA
AHGNSLRALIKHLDNISDDAIVELNIPTGQPLVYELDENLRPIRHYYLGDAAEIEAAMAA
VAAQGKAKKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgtcctcatgcgccacggcgaaagccagtggaatctggaaaaccgtttc
actggctggactgacgtcgacctgaccgaagtcggtcgcgagcaggcccgccgtgccggc
gaattgctcaagcgtgaaggttatacctttgacctggcctatgcttcggtcctcaagcgc
gccatccgcaccctctggatcgccctggacgccatggacgccatgtacaccccggtaggc
ctgaactggcggctgaatgaacgccactacggtcagctccagggcctgaacaaggccgag
acggccgccaagtacggcgacgaacaggtgctgatctggcgccgcgcctacgccatcgcg
cccgagcctctggacatcgacgatccgcgtcacccgcgctttgacagccgctacgccaag
attccggctgagcaactgcccgccacggaatgcctgcgcgacaccgtcgcccgcgtgctg
cccttctggaacgaatccattgcgccggccattcgggccggccgccgcgtgttggtcgcc
gctcacggcaacagcttgcgcgccctgatcaagcacctggacaatatctctgacgacgct
atcgtcgaactgaatatccccaccgggcagccgctggtctatgagctggatgaaaatctg
cgcccgattcgccattactatctgggcgatgccgccgagattgaagcggcgatggcggcc
gttgccgctcaaggaaaggcaaagaaggactga

DBGET integrated database retrieval system