KEGG   Bordetella avium: BAV0243Help
Entry
BAV0243           CDS       T00695                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bav  Bordetella avium
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAV0243 (gpmA)
   01230 Biosynthesis of amino acids
    BAV0243 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAV0243 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BAV0243 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAV0243 (gpmA)
Enzymes [BR:bav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAV0243 (gpmA)
Exosome [BR:bav04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAV0243 (gpmA)
  Exosomal proteins of melanoma cells
   BAV0243 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
250052..250804
Genome map
AA seq 250 aa AA seqDB search
MYKLVLMRHGESQWNLENRFTGWTDVDLTEVGREQARRAGELLKREGYTFDLAYASVLKR
AIRTLWIALDAMDAMYTPVGLNWRLNERHYGQLQGLNKAETAAKYGDEQVLIWRRAYAIA
PEPLDIDDPRHPRFDSRYAKIPAEQLPATECLRDTVARVLPFWNESIAPAIRAGRRVLVA
AHGNSLRALIKHLDNISDDAIVELNIPTGQPLVYELDENLRPIRHYYLGDAAEIEAAMAA
VAAQGKAKKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgtcctcatgcgccacggcgaaagccagtggaatctggaaaaccgtttc
actggctggactgacgtcgacctgaccgaagtcggtcgcgagcaggcccgccgtgccggc
gaattgctcaagcgtgaaggttatacctttgacctggcctatgcttcggtcctcaagcgc
gccatccgcaccctctggatcgccctggacgccatggacgccatgtacaccccggtaggc
ctgaactggcggctgaatgaacgccactacggtcagctccagggcctgaacaaggccgag
acggccgccaagtacggcgacgaacaggtgctgatctggcgccgcgcctacgccatcgcg
cccgagcctctggacatcgacgatccgcgtcacccgcgctttgacagccgctacgccaag
attccggctgagcaactgcccgccacggaatgcctgcgcgacaccgtcgcccgcgtgctg
cccttctggaacgaatccattgcgccggccattcgggccggccgccgcgtgttggtcgcc
gctcacggcaacagcttgcgcgccctgatcaagcacctggacaatatctctgacgacgct
atcgtcgaactgaatatccccaccgggcagccgctggtctatgagctggatgaaaatctg
cgcccgattcgccattactatctgggcgatgccgccgagattgaagcggcgatggcggcc
gttgccgctcaaggaaaggcaaagaaggactga

DBGET integrated database retrieval system