KEGG   Bordetella avium: BAV0515Help
Entry
BAV0515           CDS       T00695                                 

Gene name
wbpS
Definition
O-antigen biosynthesis aminotransferase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bav  Bordetella avium
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bav00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
532126..534051
Genome map
AA seq 641 aa AA seqDB search
MCGIVGLWGPLEDKTRILAESCQRIRLRGPDSKGFWEDREAGVGFGHVRLAIQDLTEAGH
QPMVSACGRYVLTYNGEVYNHLDMRAKLEQAGQAPDWRGHSDTETILAYAAAFGVQAMLR
DAVGMLAIALWDRQTRSLTLARDRMGEKPLYYGYVGANLVFASQLKGLSPVPGFGRRIDR
NALASFMRHNYVPAPQSIYEGIRKLPAASWVVFSEAQLRAREMAPPQAYWSALEVADAGQ
RQPRRFASDNEATDALQEVLLQAVRGQMLSDVRLGAFLSGGIDSSTIAALMQSQSNAPVR
TFAIGFHEKEYDEAQHAKAVAAHLGTDHSELYVTPKDALDVVPHLADIYDEPFADSSQIP
TALVTRMAREHVTVALSGDGGDELFGGYSRYLRVARWWDQCERLPAPLRALAGAAMRGST
RLPGAGAWRGKVGKMGELLRARSQGEFYRLFVSYWSDPARVVKGGEEPPSLFEQPLSGPL
FEAMMKLDTVTYMPDDILVKVDRAAMAVSLETRVPLIDHRVYEFAWSLPFNYKLRGGTGK
WLLRQVLYRHVPQSLVDRPKRGFAVPLASWLRGPLRDWAEALLDPARLRQQGWFEPEPIL
RKWREHQSGHRNWDSHLWGVLMMQAWLDRYHSGQLGEGMDP
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcgtcggtctttggggacccttggaagacaagacgcgaatcctggccgaa
agctgccagcggattcgtttgcgcgggcctgacagcaagggtttctgggaagatcgtgag
gcgggcgtaggctttggccatgtgcgcctggcgattcaggatctgaccgaggcggggcat
cagcccatggtgtccgcttgcggtcgttatgttctgacctataacggcgaggtctataac
cacctcgatatgcgcgccaagctggagcaggcggggcaggcgcccgactggcgcggccat
tccgacaccgaaacgattctggcctatgcggcggccttcggcgtgcaagccatgttgcgc
gacgctgtcggcatgttggccattgcgctgtgggatcgccagacgcgcagcttgacgctg
gcgcgcgaccgcatgggtgaaaaacccctgtactacggctatgttggcgccaatctggtg
tttgcttcgcagctcaaaggcctgtcgccggtgccggggtttggccggcggatcgaccgc
aatgcgctcgcctcctttatgcggcacaactatgtgccagcgccgcaatccatctacgaa
ggcattcgcaagctgcctgccgcaagctgggtcgtgttcagcgaagcgcagcttcgcgcc
cgtgaaatggccccgcctcaggcctattggtcggcgctggaagtcgcggatgcgggtcag
cgccagcccaggcgctttgcttccgacaatgaagccaccgatgccttgcaggaggtgttg
ttgcaggccgtgcgcggccagatgctctccgatgtgcgtctgggggcttttctgtcgggg
ggtattgattcgtccacgatcgccgcgctcatgcaaagccaaagcaatgcgccggtgcgc
actttcgctatcggctttcatgaaaaggaatacgacgaggcgcagcatgccaaggcggtc
gccgcccatctgggcacggatcactccgagctctacgtgacgcccaaggatgccctggat
gtggtgccgcacctggccgacatttatgacgaaccctttgccgactcctcgcaaattccg
actgcgctggtcacacgcatggcgcgcgagcacgtgaccgtggccctgtccggagacggc
ggcgatgagttgttcggcggctattcgcgttatctgcgcgtggcgcgctggtgggatcag
tgcgaacgcttgcccgcgccgctgcgcgccctggcgggggcggccatgcgcggttcgacc
cgtttgccaggcgctggggcatggcgcggcaaggtgggcaaaatgggagaactgctgcgg
gcccggtctcagggggagttctatcgtttattcgtgtcctattggtccgaccccgcccgt
gtcgtcaaggggggtgaggagccgccgtcgctgtttgagcagccgctcagcggccccttg
tttgaagccatgatgaagctcgacacggtgacttatatgcctgacgacattctggtcaag
gtggaccgtgcggctatggcggtcagcctggagacccgtgtgccgctcatcgatcatcgt
gtctatgagttcgcctggagtctgccgttcaattacaagctgcgcggcggcaccggtaaa
tggctgttgcgccaggtgttgtatcgccatgtgcctcaaagcctggtcgatcgtcccaag
cgcggctttgccgtgccgctggcttcctggctgcgcggtcccctgcgcgattgggccgag
gctttgcttgatcctgcccgcctgcgtcagcagggctggttcgagcccgaacccattctg
cgcaaatggcgggagcatcaaagcggccaccgcaattgggatagtcatctgtggggcgtg
ctgatgatgcaggcctggctggatcgttatcacagcggtcaactcggcgagggcatggac
ccatga

DBGET integrated database retrieval system