KEGG   Bordetella avium: BAV0520Help
Entry
BAV0520           CDS       T00695                                 

Gene name
pgm
Definition
phosphoglucomutase (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bav  Bordetella avium
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAV0520 (pgm)
   00030 Pentose phosphate pathway
    BAV0520 (pgm)
   00051 Fructose and mannose metabolism
    BAV0520 (pgm)
   00052 Galactose metabolism
    BAV0520 (pgm)
   00500 Starch and sucrose metabolism
    BAV0520 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    BAV0520 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    BAV0520 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BAV0520 (pgm)
Enzymes [BR:bav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BAV0520 (pgm)
    5.4.2.8  phosphomannomutase
     BAV0520 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(539010..>540392)
Genome map
AA seq 460 aa AA seqDB search
VKNNYPASVFKAYDIRGTVPDLIDPDFARALGYALAARAREVGNTELVIGYDGRLSSPAL
SAALQQGIHEGGVNTLDIGRVPTPLVYFGAYSLGLGAGVAITGSHNPPKYNGFKMMLGGR
ALYGEAVQSLRDAMNQPQPAGSAHGTGRNTDLVPAYIERIVSDIKLARPMKIAIDCGNGV
AGAVAPELFRALGCEVTELFCEVDGNFPNHHPDPADPHNLQDLIHCLATTDCEIGLAFDG
DGDRLGVVTKSGQIIWPDRQLILFARDVLQRCPGETIIYDVKCSRHVGLAVAAAGGQPLM
WQTGHSLVKAKLAETGAPLAGEMSGHIFFKERWYGFDDGLYTGARLLEILAREANPSALL
EALPTAVSTPELKLEMEEGQPHALIRELQEHGRFDDASQVITIDGVRAEFADGFGLARAS
NTTPVVVLRFEAENADALARIQTLFKRELLRLAPQARLPF
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataactaccctgcttcagtattcaaagcgtatgacatacgtggcactgtccct
gacctcatcgatcccgattttgcgcgcgcgctgggttatgcgctggccgcaagggcccgc
gaggtaggcaatacggagctggtcatcggttatgacggccgcctgagcagcccggcgcta
tcggcggcactgcaacagggtatccacgaaggcggggtcaacaccctggacatcggccgt
gtgcccacaccgctggtttattttggcgcgtatagcctggggctgggcgcaggcgttgcc
attaccggcagccacaatcctcccaagtacaacggcttcaaaatgatgctgggcggccgc
gccctgtatggcgaggccgtgcagtcattgcgcgatgccatgaaccagccgcagccggcc
ggcagcgcgcacggcacgggccgcaataccgacctggtgccggcctatatcgagcgcatc
gtttccgatatcaaactcgcccggcccatgaaaatcgccatcgactgcggcaacggggtg
gccggtgctgtcgcgcctgagctcttccgtgctttgggctgcgaggtgaccgagctgttc
tgcgaggtggacggcaacttccccaaccaccatccggacccggcggacccccacaatctc
caggatttgatccattgcctggccaccaccgactgcgaaatcggcctggcgtttgacggc
gacggcgaccgcctgggtgtcgtgaccaaatccggccagatcatctggcccgaccgccaa
ctgattctcttcgcgcgcgacgtattgcagcgctgccccggcgaaaccattatttacgac
gtgaaatgcagccgccatgtgggcctggcggtcgccgcagcgggcggccagccgctcatg
tggcagaccggccactcgctggtgaaggccaaactggccgaaaccggcgcaccgctggcg
ggcgaaatgagcgggcatattttcttcaaggaacgttggtacggtttcgacgacggcctg
tataccggggcgcgcctgctggaaattctcgcgcgagaagccaacccctcggcgctgctg
gaagccttgcccaccgccgtctccacgccggagctcaagctcgaaatggaagaaggccag
cctcacgcgctgatccgcgagctgcaagagcatggccgtttcgacgacgcctcacaggtc
atcaccatcgatggcgtgcgggccgagttcgccgacggtttcgggctggcgcgcgcatcg
aacaccaccccggtggtcgtgctgcgcttcgaagccgaaaacgccgacgcgctggcccgc
attcaaaccctgttcaaacgagagctattgcgcctggcgcctcaagcccgcttgccattc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system