KEGG   Bordetella avium: BAV0599Help
Entry
BAV0599           CDS       T00695                                 

Gene name
bphG
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bav  Bordetella avium
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BAV0599 (bphG)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAV0599 (bphG)
   00650 Butanoate metabolism
    BAV0599 (bphG)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BAV0599 (bphG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAV0599 (bphG)
   00622 Xylene degradation
    BAV0599 (bphG)
   00621 Dioxin degradation
    BAV0599 (bphG)
Enzymes [BR:bav01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BAV0599 (bphG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
621855..622805
Genome map
AA seq 316 aa AA seqDB search
MTRRLKAAIIGSGNIGTDLMIKILRHGKHIDMAAMVGIDPKSDGLARAARLGVATTYEGV
AGLIRLPVFADIDFVFDATSAGAHVENDALLRAAKPGIRLVDLTPAAIGPYCIPVVNGDA
HLDALNVNMVTCGGQATIPMVAAVSRVARVHYAEIVASIASKSAGPGTRANIDEFTETTA
KAIEAVGGATKGKAIIVMNPAEPPLIMRDTVYTLSQPADEEAIAESVERMVAAVQAYVPG
YRLKQKVQFDRIDSPLRIPGVGDALKGLKTSIFLEVEGAAHYLPAYAGNLDIMTSAALRT
AEHMAQRMLADATVSA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtagactcaaggccgccatcatcggcagcggcaatatcggcacggacttgatg
atcaagattctgcgccacggtaaacacatcgacatggcggccatggtcggcatcgacccc
aagtccgatgggttggcgcgcgccgcccgcctgggtgtcgcgaccacttatgaaggcgtt
gccggcctgatccgtctgcctgtcttcgcggatatcgacttcgtcttcgatgcgaccagt
gccggcgcgcatgtggagaacgacgccttgctgcgcgcggccaagccgggtatccgactg
gtcgacctcacgcctgcagcgatcggcccctattgcattccggtggtcaatggcgacgcg
cacctggatgcgctcaacgtgaatatggtcacctgcggcggccaggcgaccattcccatg
gtggccgctgtgtcgcgcgtcgcccgcgtgcattacgcggaaatcgtcgcatcgatcgcc
agcaagagcgccggtcccggcacacgcgcgaacatcgacgagttcaccgagacgaccgcc
aaggccatcgaggcagtgggcggcgcgacgaagggcaaggccatcatcgtcatgaatccc
gccgagccgccgctcatcatgcgcgacaccgtctataccctgagccagcccgccgacgag
gaggcgatcgcggaatcggtggagcgcatggttgccgcggtgcaggcttacgtaccgggc
tatcgccttaaacaaaaagtgcagttcgaccgcatcgacagccccctacgcattcccggt
gtgggcgatgcgcttaagggtctgaagacctccatcttcctggaggtcgagggggccgca
cactatctgcctgcctatgccggcaacctggacatcatgactagcgccgccctgcgcacc
gcggaacacatggcccaacgcatgttggccgacgccaccgtctctgcctga

DBGET integrated database retrieval system