KEGG   Bordetella avium: BAV0710Help
Entry
BAV0710           CDS       T00695                                 

Gene name
caiD
Definition
(GenBank) carnitinyl-coa dehydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bav  Bordetella avium
Pathway
bav00071  Fatty acid degradation
bav00280  Valine, leucine and isoleucine degradation
bav00281  Geraniol degradation
bav00310  Lysine degradation
bav00360  Phenylalanine metabolism
bav00362  Benzoate degradation
bav00380  Tryptophan metabolism
bav00410  beta-Alanine metabolism
bav00627  Aminobenzoate degradation
bav00640  Propanoate metabolism
bav00650  Butanoate metabolism
bav00903  Limonene and pinene degradation
bav00930  Caprolactam degradation
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01120  Microbial metabolism in diverse environments
bav01130  Biosynthesis of antibiotics
bav01212  Fatty acid metabolism
Module
bav_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BAV0710 (caiD)
   00650 Butanoate metabolism
    BAV0710 (caiD)
  Lipid metabolism
   00071 Fatty acid degradation
    BAV0710 (caiD)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAV0710 (caiD)
   00310 Lysine degradation
    BAV0710 (caiD)
   00360 Phenylalanine metabolism
    BAV0710 (caiD)
   00380 Tryptophan metabolism
    BAV0710 (caiD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAV0710 (caiD)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BAV0710 (caiD)
   00281 Geraniol degradation
    BAV0710 (caiD)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAV0710 (caiD)
   00627 Aminobenzoate degradation
    BAV0710 (caiD)
   00930 Caprolactam degradation
    BAV0710 (caiD)
Enzymes [BR:bav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BAV0710 (caiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: CAJ48316
UniProt: Q2KX73
Position
734648..735415
Genome map
AA seq 255 aa AA seqDB search
MSELIKVEVTGGIQIITINRPDAKNAINLETAEAMAAALDQLDASDDIRIGILTGAGGTF
SSGMDLKAFAQSRQRPLIPGRGFAGLNERPPKKPLIAAVEGYALAGGCEMALACDLIVAA
GNAKFGLPEVKRGLVAGSGGMIRLPRRLPYHVAMEIVLTGDMLSAERAYQLGLVNRLTEA
GQALEGALTLARVIVENGPLAVQTAKGIVQQSLDWQQSEMFERQRPLIAHIFESADAKEG
ATAFAEKRKPVWQGK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaactcatcaaggtggaagtcaccggcggtattcagatcatcacgatcaatcgt
cccgacgccaaaaacgccatcaatctggaaaccgccgaggcgatggccgccgcgctggat
cagctggacgccagcgatgacatccgcatcggtattctcactggcgcgggcggcaccttt
tcatcgggcatggatctcaaggcctttgcgcaaagccgccagcgcccgctgattccgggt
cgggggttcgccggtttgaacgagcgcccgcccaaaaagccgctgatcgccgcggttgag
ggctatgccctggcggggggctgcgagatggcgctggcctgcgatctgattgtggccgcc
ggtaatgccaaattcggcctgccggaagtcaagcgtggcctggttgccggttcgggcggc
atgatccgcctgccgcgccgcctgccttatcacgtcgccatggaaatcgtcctgaccgga
gacatgctgagcgccgagcgggcctatcagcttggcctggtcaatcgcctgaccgaagcc
ggtcaggcgctcgaaggcgcgctgaccctggcccgcgtcatcgtcgagaacggccccctg
gccgtgcagaccgccaagggcatcgtgcagcagtcgctggattggcagcaatccgaaatg
ttcgagcgccagcgtccgctgatcgcgcatattttcgagtccgccgacgccaaggaaggc
gcgaccgccttcgccgaaaaacgcaagccggtgtggcagggcaaataa

DBGET integrated database retrieval system