KEGG   Bordetella avium: BAV0710Help
Entry
BAV0710           CDS       T00695                                 

Gene name
caiD
Definition
enoyl-CoA hydratase (EC:4.2.1.-)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bav  Bordetella avium
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BAV0710 (caiD)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BAV0710 (caiD)
   00650 Butanoate metabolism
    BAV0710 (caiD)
  Lipid metabolism
   00071 Fatty acid degradation
    BAV0710 (caiD)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAV0710 (caiD)
   00310 Lysine degradation
    BAV0710 (caiD)
   00360 Phenylalanine metabolism
    BAV0710 (caiD)
   00380 Tryptophan metabolism
    BAV0710 (caiD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAV0710 (caiD)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BAV0710 (caiD)
   00281 Geraniol degradation
    BAV0710 (caiD)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAV0710 (caiD)
   00627 Aminobenzoate degradation
    BAV0710 (caiD)
   00930 Caprolactam degradation
    BAV0710 (caiD)
Enzymes [BR:bav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BAV0710 (caiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
734648..735415
Genome map
AA seq 255 aa AA seqDB search
MSELIKVEVTGGIQIITINRPDAKNAINLETAEAMAAALDQLDASDDIRIGILTGAGGTF
SSGMDLKAFAQSRQRPLIPGRGFAGLNERPPKKPLIAAVEGYALAGGCEMALACDLIVAA
GNAKFGLPEVKRGLVAGSGGMIRLPRRLPYHVAMEIVLTGDMLSAERAYQLGLVNRLTEA
GQALEGALTLARVIVENGPLAVQTAKGIVQQSLDWQQSEMFERQRPLIAHIFESADAKEG
ATAFAEKRKPVWQGK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaactcatcaaggtggaagtcaccggcggtattcagatcatcacgatcaatcgt
cccgacgccaaaaacgccatcaatctggaaaccgccgaggcgatggccgccgcgctggat
cagctggacgccagcgatgacatccgcatcggtattctcactggcgcgggcggcaccttt
tcatcgggcatggatctcaaggcctttgcgcaaagccgccagcgcccgctgattccgggt
cgggggttcgccggtttgaacgagcgcccgcccaaaaagccgctgatcgccgcggttgag
ggctatgccctggcggggggctgcgagatggcgctggcctgcgatctgattgtggccgcc
ggtaatgccaaattcggcctgccggaagtcaagcgtggcctggttgccggttcgggcggc
atgatccgcctgccgcgccgcctgccttatcacgtcgccatggaaatcgtcctgaccgga
gacatgctgagcgccgagcgggcctatcagcttggcctggtcaatcgcctgaccgaagcc
ggtcaggcgctcgaaggcgcgctgaccctggcccgcgtcatcgtcgagaacggccccctg
gccgtgcagaccgccaagggcatcgtgcagcagtcgctggattggcagcaatccgaaatg
ttcgagcgccagcgtccgctgatcgcgcatattttcgagtccgccgacgccaaggaaggc
gcgaccgccttcgccgaaaaacgcaagccggtgtggcagggcaaataa

DBGET integrated database retrieval system