KEGG   Bordetella avium: BAV0895Help
Entry
BAV0895           CDS       T00695                                 

Definition
agmatinase/arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bav  Bordetella avium
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bav00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
943149..944039
Genome map
AA seq 296 aa AA seqDB search
MDLPAPSVQDEAPGVCVLGIPFDCGTHPFRVGSRQGPDAIREQSRLLRPFDLFRRAGVEN
PAQFLRAVDAGNVVCWPGDPERSYPVIETAVDRILEAGAIPVTMGGDGAVTLPQLRAVGR
RHPGLVVLHFDAHTDTYPVSGYNTASTFTRAAEETLLDVSASFHVGTRGNSFMGGVVEYS
REVGYTVIPFDDFDRDQVAMLDEIKRRVGDRPVYLCFDMDVFDPSCAPGVCTPEWGGLTA
KEGLALLRRLSGLNFVAFDVNTVSPPQDVGGATAFLAATVMQEFLALAVAAIRRHA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcctgcgccgtcggtgcaagatgaagcgccaggggtctgtgtattgggcatt
ccgtttgattgcggcacccatccctttcgtgtcggatcgcgccaggggccggacgccatc
cgcgaacagtcgcggctattgcggccttttgatttgtttcgccgtgcgggcgtggagaac
cccgcgcagttcttgcgggccgtggatgcgggcaatgtggtgtgttggcctggcgacccc
gagcgctcctatcctgtgatcgagacagcggtggatcgcatcctggaggctggcgccatt
cctgtcacgatgggtggagatggggcagtgaccttgccgcagttgcgggcggtgggacgg
cgtcatcccggtctggtagtgctgcatttcgatgcgcataccgatacttacccggtttcc
ggctacaacacggcaagcacctttacccgagccgccgaagaaaccctgctggacgtaagc
gccagctttcatgtgggcacacgcggcaactcttttatgggcggtgtggtcgagtatagc
cgcgaggtcggctataccgtgattcccttcgatgattttgaccgcgaccaggtggcgatg
cttgacgagatcaagcgccgcgtcggcgatcgtccggtctatctgtgtttcgatatggac
gttttcgacccttcttgtgcgccgggtgtgtgtacgcccgaatggggcgggttgacggcg
aaggagggtctggccctgctgcggcgcctatcgggcctgaacttcgtggcattcgacgtg
aacaccgtatcgccgcctcaggatgtcggcggcgccacggcctttctggctgcgaccgtg
atgcaggagtttcttgcattggccgtcgccgctatccggcgccatgcctaa

DBGET integrated database retrieval system