KEGG   Bordetella avium: BAV1025Help
Entry
BAV1025           CDS       T00695                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
bav  Bordetella avium
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bav00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BAV1025 (cheB)
Enzymes [BR:bav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BAV1025 (cheB)
Two-component system [BR:bav02022]
 CheA family
  WspE-WspRF
   BAV1025 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1098194..1099222
Genome map
AA seq 342 aa AA seqDB search
MRVAIVNDMPLAVEALRRSLAHDPELSLAWIASDGLQAVRRCAADLPDVILMDLMMPVMN
GVEATRLIMAESPCAIIVVTSDVLQHTSLVFEAMGHGALDAVDTPVLGRGDPKAAAQRLL
RKIRNAGWLIGKKTVALERTTAMASSDTDAALVVIGASAGGPPSLAAVLRALPASFPAAI
VLVQHVDAAFTSGMAAWLNEQCVLPVRLASDGLRPEAGVVLLAGAGEHLVLGAERKLHYT
TEPRESVYSPSIDVFFHSVAQHWRGRAAGVLLTGMGQDGALGLKAMRERGFFTIAQDRAT
SAVYGMPKAAAALDAACEILPLGDIAPRLEKVFAPPANPLFN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgccatcgtcaacgatatgcctttggcggtcgaggctttgcgacgctcgctg
gcgcatgatccggagctgagtctggcctggatcgccagcgatggcttgcaggctgtgcgc
cggtgcgcggccgacctgccggatgtgatcctgatggatttgatgatgccggtcatgaac
ggcgtggaggcgacccgcctcatcatggccgaatcgccttgcgccatcattgtcgtgacc
tcggatgtcctgcagcacacgtcgttggtgttcgaggcgatgggacatggggcgctcgac
gctgtcgataccccggtgctgggccggggcgatcccaaggctgccgcacagcggctgctg
cggaaaattcgtaatgccggctggctcatcggcaagaaaacggtggcgctcgagcgaacg
accgccatggcctcttccgataccgacgccgccttggtggtcatcggcgcctcggcgggc
gggccgccctctctggccgccgttctgcgggccttgccagccagttttcctgccgccatt
gtgctggttcagcatgtagacgccgccttcacctcaggcatggcggcatggttgaatgag
cagtgcgtgctgccggtgcggcttgcctccgatgggctgcggcccgaggcaggcgtggtg
ctcttggccggcgcgggcgaacatctcgtgttgggcgccgagcgcaagctccactacacc
acagagccgcgcgaaagcgtatatagcccctcgatcgacgtgtttttccacagcgttgct
cagcattggcgcggccgcgccgccggggtgctgctgaccggcatgggccaggatggcgct
ctcggtctgaaggctatgcgcgaacggggctttttcacgattgcccaggatcgcgccacc
agtgccgtgtatggcatgcccaaggccgctgctgctttggacgccgcctgtgaaattctg
cctttgggcgatatcgcgccgcgcctcgaaaaggttttcgcgccgccagccaatccgctc
tttaactag

DBGET integrated database retrieval system