KEGG   Bordetella avium: BAV1077Help
Entry
BAV1077           CDS       T00695                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K16784  
biotin transport system ATP-binding protein [EC:3.6.3.-]
Organism
bav  Bordetella avium
Pathway
ABC transporters
Module
Biotin transport system
Brite
KEGG Orthology (KO) [BR:bav00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BAV1077
Enzymes [BR:bav01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     BAV1077
Transporters [BR:bav02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Biotin transporter [MD:M00581] [OT]
    BAV1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1152544..1153221
Genome map
AA seq 225 aa AA seqDB search
MLIEFDETVVTMDGRQRLSVPRLTLSERRIGIAGPNGAGKSTFSRLINGLLLPDQGRVRV
NGLDTRRDAQAIRRQVGFVFQNPDNQIVFPIVREDLDFGLKPLGLPSAERAMRVSAQLAS
LGISALADRSSFSLSGGERQLVALAAVLVRDPALIVFDEPTTQLDLRNRNRVRDAIAALA
PMAIVVSHDLELLADFDRVLVIDDGRIAADDQPAAALRWYREHCS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgttaatcgagtttgatgagacggtcgtgacgatggacggcaggcagcgtttgagcgtg
cctcggctgaccctgtctgaacgccgtatcggtattgccggccccaatggcgccggtaaa
agcaccttttcacgcctgataaatggcctgctgctgccggaccaggggagggtgcgcgtc
aatggtctggacacacgccgcgatgcgcaggccatccgccgtcaggtcggttttgtgttc
cagaatcccgataatcaaattgtttttcccattgtgcgggaagacctcgattttggcttg
aagcctctgggtctgccgtccgcagagcgcgccatgcgcgtgtcggctcagcttgccagc
ctggggatcagcgccttggccgaccgcagcagtttcagcctgtcgggcggcgagcggcag
ttagtggcgctcgccgcggtgctggtgcgcgaccccgcgctgattgtgttcgatgagccg
accacgcagctggatctgcgtaatcgcaatcgggtgcgcgatgccattgccgccctggcg
cccatggccatcgtggtcagccacgatctggagctcctggcggacttcgaccgggtgctg
gtgatcgacgatggccgcatcgcggccgatgaccagccggccgcagccttgcgttggtac
cgggagcattgctcatga

DBGET integrated database retrieval system