KEGG   Bordetella avium: BAV1077Help
Entry
BAV1077           CDS       T00695                                 

Definition
ABC transporter ATP-binding protein
Orthology
K16784  
biotin transport system ATP-binding protein [EC:3.6.3.-]
Organism
bav  Bordetella avium
Pathway
ABC transporters
Module
Biotin transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:bav02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1152544..1153221
Genome map
AA seq 225 aa AA seqDB search
MLIEFDETVVTMDGRQRLSVPRLTLSERRIGIAGPNGAGKSTFSRLINGLLLPDQGRVRV
NGLDTRRDAQAIRRQVGFVFQNPDNQIVFPIVREDLDFGLKPLGLPSAERAMRVSAQLAS
LGISALADRSSFSLSGGERQLVALAAVLVRDPALIVFDEPTTQLDLRNRNRVRDAIAALA
PMAIVVSHDLELLADFDRVLVIDDGRIAADDQPAAALRWYREHCS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgttaatcgagtttgatgagacggtcgtgacgatggacggcaggcagcgtttgagcgtg
cctcggctgaccctgtctgaacgccgtatcggtattgccggccccaatggcgccggtaaa
agcaccttttcacgcctgataaatggcctgctgctgccggaccaggggagggtgcgcgtc
aatggtctggacacacgccgcgatgcgcaggccatccgccgtcaggtcggttttgtgttc
cagaatcccgataatcaaattgtttttcccattgtgcgggaagacctcgattttggcttg
aagcctctgggtctgccgtccgcagagcgcgccatgcgcgtgtcggctcagcttgccagc
ctggggatcagcgccttggccgaccgcagcagtttcagcctgtcgggcggcgagcggcag
ttagtggcgctcgccgcggtgctggtgcgcgaccccgcgctgattgtgttcgatgagccg
accacgcagctggatctgcgtaatcgcaatcgggtgcgcgatgccattgccgccctggcg
cccatggccatcgtggtcagccacgatctggagctcctggcggacttcgaccgggtgctg
gtgatcgacgatggccgcatcgcggccgatgaccagccggccgcagccttgcgttggtac
cgggagcattgctcatga

DBGET integrated database retrieval system