KEGG   Bordetella avium: BAV1103Help
Entry
BAV1103           CDS       T00695                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bav  Bordetella avium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAV1103 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAV1103 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAV1103 (trpA)
Enzymes [BR:bav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAV1103 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1179814..1180668
Genome map
AA seq 284 aa AA seqDB search
MSQRIAAAFSRVAEAGRASALIPYIAAGDPSPAATVPLMHGLVKAGADVLELGVPFSDPM
ADGPVIQRAAERAIAQGMGLSLVLQAVAEFRLTDSITPVVLMGYANPIERMGQEAFAQAA
CDAGVDGVLVVDYPPEEMDEFGVALNRAGVAPIFLIAPTTTEARMQSIGRVARGYAYYVS
LKGVTGSGSLNTEDVAQRLAVIRRHIGDLPVGVGFGIRDAESASRIALHADAVVIGSKLI
ETMEQAIVNVPPAEQTDAAVKAASQWLGGIRAALDQVKRERAQG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacgaattgccgccgctttttcccgtgtcgccgaggcgggtcgcgcctcggct
ttgattccctatatcgcagcgggcgatccctcgcccgctgcgaccgtaccgctgatgcac
gggctcgtgaaggccggcgccgatgtgctcgaactgggtgtgccgttttcagatccgatg
gctgatggcccggtgatccagcgcgccgcagagcgcgccatcgcgcagggcatgggcttg
tcgctagtgctgcaagccgtggccgagtttcgtctcacggacagcatcacgcccgtcgtg
ctgatgggttatgccaacccaatcgaacgcatggggcaagaggcttttgcgcaggcagcc
tgcgatgccggcgtggacggcgtgctggtggtcgattatccccccgaagaaatggatgag
ttcggcgtcgccctgaatcgggccggtgtcgccccgatttttctgattgcccccaccacc
accgaggcgcgcatgcagtccatcggccgggtggcgcgaggttatgcctactacgtgtcg
ctcaagggcgtcacgggctcgggcagcttgaataccgaggatgtggcgcaacgtctggcc
gtcatccgccgccacatcggcgacctgccggtgggggtgggtttcggcattcgtgatgcc
gagagcgccagccgcattgcgcttcatgctgacgccgtcgttattggcagcaaactcatc
gaaaccatggagcaggctatcgtcaatgtgccgcctgctgaacagaccgacgccgcggtc
aaggccgccagccagtggctgggcggcatccgcgccgcgctggatcaagttaaacgagag
cgcgcgcagggctga

DBGET integrated database retrieval system