KEGG   Bordetella avium: BAV1136Help
Entry
BAV1136           CDS       T00695                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bav  Bordetella avium
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BAV1136 (holC)
   00240 Pyrimidine metabolism
    BAV1136 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BAV1136 (holC)
   03430 Mismatch repair
    BAV1136 (holC)
   03440 Homologous recombination
    BAV1136 (holC)
Enzymes [BR:bav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BAV1136 (holC)
DNA replication proteins [BR:bav03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BAV1136 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1210919..1211356)
Genome map
AA seq 145 aa AA seqDB search
MTRIDFAFGAADRLRAACQTARKRYLAGQRLIVYCSDANRLSAFDRLLWAFDDISFVPHV
LARDALAAHTPIVLTATNPQQAAALAPDAWLLNLDDACPPHYDDFPRVLEIVSGNDTDRA
AARVRWRDYVAAGHTPHSHDLSRSA
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaatcgacttcgcctttggcgccgcggatcggctgcgggcagcctgccagact
gcccgcaaacgctatctggcaggccaacgcctcattgtctattgcagcgacgccaaccgc
ctgtcagccttcgaccgcttgctgtgggcctttgacgatatttccttcgtgccgcatgtg
ctggcgcgtgacgccttggcggcccacacacccatcgtgctcaccgccacgaacccgcaa
caggctgccgcactcgctccggacgcctggctgcttaatctggatgacgcctgcccgccg
cactatgacgatttcccccgcgtgctcgaaatcgtctccggcaacgacactgaccgcgca
gccgcccgggtgcgttggcgcgattacgtcgcggccggccacaccccgcacagccacgac
ctgagccgcagcgcctga

DBGET integrated database retrieval system