KEGG   Bordetella avium: BAV1183Help
Entry
BAV1183           CDS       T00695                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bav  Bordetella avium
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAV1183 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAV1183 (sdhD)
   00650 Butanoate metabolism
    BAV1183 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BAV1183 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1263544..1263927
Genome map
AA seq 127 aa AA seqDB search
MQDSKNYGPKRLVVGAHYGTIDFIAQRLTAVIMAVYTLVLIIGLLIMPAYNYENWKALFT
FHVFAIPLGQILASLAFFALAWHAWIGVRDIWMDYIRPVGLRLLLQVLTVLWLVGSVVYF
AQIIWRI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacagcaaaaattacggtcccaagcgcctggtcgtcggcgcccattacggcacc
atcgatttcatcgctcaacgcctcacggcggtcatcatggccgtctacacgctggtgttg
attatcggcctgctgattatgccggcctacaactatgaaaactggaaggcgctgttcacc
ttccacgtcttcgccattccgctgggccagattctggcctcgctcgctttctttgcgctg
gcctggcacgcctggatcggcgtgcgcgacatctggatggattacatccggccggtgggc
ttgcgcctgctgttgcaagtgctgaccgtcttgtggctggttggctcggtcgtgtacttc
gcgcaaatcatctggagaatctaa

DBGET integrated database retrieval system