KEGG   Bordetella avium: BAV1183Help
Entry
BAV1183           CDS       T00695                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bav  Bordetella avium
Pathway
bav00020  Citrate cycle (TCA cycle)
bav00190  Oxidative phosphorylation
bav00650  Butanoate metabolism
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01120  Microbial metabolism in diverse environments
bav01130  Biosynthesis of antibiotics
bav01200  Carbon metabolism
Module
bav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bav_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAV1183 (sdhD)
   00650 Butanoate metabolism
    BAV1183 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BAV1183 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Bap31
Motif
Other DBs
NCBI-ProteinID: CAJ48791
UniProt: Q2L1X4
Position
1263544..1263927
Genome map
AA seq 127 aa AA seqDB search
MQDSKNYGPKRLVVGAHYGTIDFIAQRLTAVIMAVYTLVLIIGLLIMPAYNYENWKALFT
FHVFAIPLGQILASLAFFALAWHAWIGVRDIWMDYIRPVGLRLLLQVLTVLWLVGSVVYF
AQIIWRI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacagcaaaaattacggtcccaagcgcctggtcgtcggcgcccattacggcacc
atcgatttcatcgctcaacgcctcacggcggtcatcatggccgtctacacgctggtgttg
attatcggcctgctgattatgccggcctacaactatgaaaactggaaggcgctgttcacc
ttccacgtcttcgccattccgctgggccagattctggcctcgctcgctttctttgcgctg
gcctggcacgcctggatcggcgtgcgcgacatctggatggattacatccggccggtgggc
ttgcgcctgctgttgcaagtgctgaccgtcttgtggctggttggctcggtcgtgtacttc
gcgcaaatcatctggagaatctaa

DBGET integrated database retrieval system