KEGG   Bordetella avium: BAV1204Help
Entry
BAV1204           CDS       T00695                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bav  Bordetella avium
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAV1204 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAV1204 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BAV1204 (odhB)
Enzymes [BR:bav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BAV1204 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1292971..1294170
Genome map
AA seq 399 aa AA seqDB search
MAITDVVVPQLSESVSEATLLTWKKQPGAAVEADEILIEIETDKVVLEVPAPASGVLAEI
VKADGATVTSGELIARIDTAAKAAAAPAAAAAAPAAPAAPAAASTSAAGVASPAAAKILA
EKGVDAASVAGTGRDGRVTKGDALAANAAPAKKAAAPVAPPTLSLDGRPEQRVPMSRLRA
RVAERLLQSQQENAILTTFNEVNMQGVIDLRNKYKEKFEKEHGVKLGFMSFFVKAAVAAL
KKYPVLNASVDGKDIIYHGYFDIGIAVGSPRGLVVPILRNADQLTIAEIEKTIADFGKRA
SEGKLGIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAILGVHATKERPVVENGQIVIRP
INYLAMSYDHRIIDGREAVLGLVAMKEALEDPQRLLLDL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctattactgacgttgttgtgccccagctttccgaatcggtttcggaagcaaccctg
ctgacctggaagaagcagcccggcgctgctgtcgaggcagacgaaatcctgatcgaaatc
gagaccgacaaggtcgtgctcgaagtgcccgctcccgcctcgggcgtgctggctgagatt
gtcaaggctgacggcgccaccgtgacctcgggcgagttgatcgcccgcatcgataccgcc
gccaaggcggctgcagctcccgcagctgcggcagctgcaccggctgcgcctgccgcaccg
gctgctgccagcacctcggctgctggcgtggcttcgcctgccgctgccaagattctggct
gaaaagggtgtggatgctgccagcgtggccggtaccggccgtgatggccgcgtcaccaag
ggcgatgccctggctgccaatgccgctccggccaagaaggctgctgctccggtcgcgccg
cccaccctgtcgctggacggccgtccggaacagcgtgtgccgatgagccgcctgcgcgct
cgcgtggcagagcgtctcctgcaatcgcagcaagaaaacgccattttgacgacgtttaac
gaagtcaacatgcaaggcgtgatcgacctgcgcaataagtacaaggaaaagttcgagaaa
gagcacggcgtgaagctgggctttatgtccttctttgtgaaggccgcagtggccgccctg
aagaagtacccggtcttgaacgcctcggtcgatggcaaggacatcatctaccacggttac
ttcgacatcggcatcgctgtgggcagcccgcgcggtctggtcgtgcctatcctgcgcaat
gccgatcaactgaccatcgctgaaatcgagaagaccattgccgatttcggcaagcgtgct
tccgaaggcaagctgggtatcgaagaaatgaccggcggcaccttctctatctcgaacggt
ggcgtgttcggttcgatgctctcgaccccgatcatcaacccgccgcaatcggccattctt
ggcgtgcatgccaccaaggagcgcccggttgtcgagaacggccagatcgtgattcgcccg
atcaattacctggccatgtcctatgaccaccgcatcatcgacggccgtgaagccgtgctg
ggtctggtcgccatgaaggaagcgctggaagatccgcaacgtctgttgctggatctgtaa

DBGET integrated database retrieval system