KEGG   Bordetella avium: BAV1338Help
Entry
BAV1338           CDS       T00695                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bav  Bordetella avium
Brite
Enzymes [BR:bav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     BAV1338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1410595..1411050
Genome map
AA seq 151 aa AA seqDB search
MDKGKIAAGVVSAAIALVAAWEGRSLIAYADPVGIPTICEGFTHGVKLGDVATPERCDAL
TEQEVRRALAVVDGSVPRPLPDSVRVALASFVYNVGPGAYGGSTLTRKLRAGDLAGACRE
LPRWVYAGGTKLRGLERRRDAEMRICLSDLQ
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggataaggggaagatcgccgcaggcgttgtgtcggcagccatcgccctggtggccgcc
tgggaggggcgctcactgatcgcgtatgccgatccggtcggcataccgacgatctgcgag
gggtttactcatggggtgaagttgggggacgtggccacgcctgaacgatgcgatgcgctg
actgagcaggaggtgcgccgggcgctcgccgtagtggacggatctgtgccgcgcccgttg
ccggacagcgtgcgggtggcgctggccagttttgtgtacaacgtcgggcctggtgcatac
ggcgggtctacgctgacgcgcaagttgcgcgctggtgatctggccggggcttgccgtgag
ctgccgcgatgggtttacgcgggaggaaccaagctgcgcggccttgagcggcggcgcgat
gcggagatgcggatatgcctgtccgatttgcagtga

DBGET integrated database retrieval system