KEGG   Bordetella avium: BAV1416Help
Entry
BAV1416           CDS       T00695                                 

Definition
stearoyl-CoA desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bav  Bordetella avium
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BAV1416
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BAV1416
Enzymes [BR:bav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BAV1416
Lipid biosynthesis proteins [BR:bav01004]
 Desaturase
  First
   BAV1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1486687..1487895
Genome map
AA seq 402 aa AA seqDB search
MDYILSFLSGGLTQASWWQIVAFTLIVTHITIVAVTVFLHRSQAHRGLDLHPAVMHFFRF
WLWMTTGMVTKEWVAIHRKHHAKCEKEGDPHSPMLFGIWKVLFRGAELYRQESTNKETMA
KFGHGTPDDWLERNLYAKHSLWGVLTMLAIDVALFGAIGLTVWAVQMAWIPFWAAGVVNG
VGHYWGYRNYNSPDTSTNVFPWGFIIGGEELHNNHHAHGTSAKFSAKWYEIDVGWGYITV
LRWLGLAKVKKVAPKLTLDPDAKAIDLRTLQGVITHRYEVMARYADVIKKAAGEELNKLK
ASRRKGSADCNWTLLNRVRRTLTRNEEVLQPAQLAEVDQVIAKNASLSTLVQMRRELGRI
WESSSASSEQLLQDLQAWCQRAQQSGIAGLEQFALHLRRYAA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggattacatcctttcttttctgtctggtggtctgactcaggccagctggtggcagatt
gtggcgttcacgctcatcgtgacgcacattacgatcgtagcagttaccgtctttttgcat
cgcagccaggcgcaccgaggccttgacctgcatcccgccgtcatgcatttcttccgattc
tggctgtggatgaccacgggcatggtgacgaaggagtgggtggccattcatcgcaagcat
cacgccaagtgcgaaaaggaaggcgatccgcactcgcccatgctgttcggcatctggaag
gtgctgttccgcggcgcagaactctatcgccaagagtccaccaacaaggaaaccatggcc
aagttcggccacggcacgcccgatgattggctcgagcgtaatctctatgccaagcacagc
ctgtggggcgtgctgaccatgctcgccattgacgtggccttgttcggcgccatcggcctg
accgtctgggccgtgcaaatggcttggattcccttctgggctgccggcgttgtcaacggg
gtgggccactactggggctaccgcaattacaacagccctgacaccagcaccaatgtgttc
ccctggggcttcatcatcggcggcgaagagctgcacaacaaccaccatgctcatggcacc
tcggccaagttctcggccaagtggtacgaaatcgacgtgggttggggctatatcaccgtg
ctgcgctggctggggctggccaaggtcaagaaggtcgctcccaagctgactctggaccct
gatgccaaggcgatcgatctgcgcaccttgcaaggcgtcatcacccaccgctacgaagtc
atggcccgttatgccgacgttatcaagaaggcggctggcgaagagctcaacaagctcaaa
gcctcgcgccgcaagggtagcgccgactgcaactggaccctgctcaaccgcgttcgccgc
acgctgacccgcaacgaagaggtgctgcagcctgcacagctcgccgaggttgatcaggtc
atcgccaagaacgcttccctgtccacgctggtgcagatgcgccgggaactgggccgtatc
tgggagagctccagcgccagcagcgagcagctgttgcaggatctgcaagcctggtgccag
cgcgcccagcaaagcggcatcgctggcctcgagcagttcgcgctgcacctgcgccgctac
gcggcatga

DBGET integrated database retrieval system