KEGG   Bordetella avium: BAV1832Help
Entry
BAV1832           CDS       T00695                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bav  Bordetella avium
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BAV1832
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BAV1832
Enzymes [BR:bav01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BAV1832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1923058..1923552
Genome map
AA seq 164 aa AA seqDB search
MTTFYDFSAPSLSAESIPLSQWRGQVVLVVNVASQCGFTPQYSGLEALYQRFGAQGFTVL
GFPCNQFGRQEPGDADEIRRFCDTRYGITFPLFAKIDVNGGDAHPLFRWLKSQKPGVLGT
EVIKWNFTKFLIGRDGQVLARYAPTDAPDSLVADIEKALAAPAA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccttttatgacttcagcgcaccatccctcagcgccgagtccattcccttatcg
caatggcgtggtcaagtcgtgctggtggtcaacgtggcttcccaatgcggtttcacgccg
caatactccggcctagaggcgctgtatcagcgcttcggagcgcagggtttcacggtgctg
ggctttccctgcaaccaatttggccgccaggaacccggcgatgccgacgagatccgccgg
ttctgcgacacccgctacggcattaccttccccctgttcgccaagatcgacgtcaatggt
ggcgacgctcacccgctctttcgctggctgaagtcgcaaaaacccggcgtgctgggcacc
gaggttatcaaatggaacttcaccaagttcctgatcggccgcgacggacaggtgctggcc
cgctacgcgccgactgacgcgcccgacagccttgttgccgatatcgaaaaagccctggct
gcacccgccgcctga

DBGET integrated database retrieval system