KEGG   Bordetella avium: BAV1968Help
Entry
BAV1968           CDS       T00695                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bav  Bordetella avium
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bav01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2111458..2112066
Genome map
AA seq 202 aa AA seqDB search
MLPPAQAQTASATQGSHTILVVGDSLSAEYGLKRGAGWVPLLAQRVSEQYPNYRVVNASI
SGDTTSGGKARLPALLTQHQPAVVVLELGSNDALRGLPLNMTQDNLSAMTQQAKSAGAKV
LIVGMQIPPNYGRDYTERFAKVFQNVAEKEKARLVPFLMEGIATDRALFQADGIHPNEMA
QPALLNNVWPGLQPLLSDQAGG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgccggctcaagctcagactgcatctgctacccagggttcccataccatcctg
gtggtcggcgacagtctttctgccgaatatggcctgaaacggggcgcgggctgggtgccg
cttctggcgcagcgcgtgtcagaacaatacccaaattatcgggtggtcaatgcgagcatc
agcggcgacaccaccagcggcggcaaggcgcgtctgcctgctttgctgactcagcaccaa
cccgcggtggtggtgctggaactaggctccaatgacgccctgcgcggcctgcccctgaac
atgacgcaagacaatctgagcgccatgacgcaacaggccaaatcggcaggcgccaaagtg
ctgatcgtgggtatgcagataccgcccaactatggccgcgattacaccgagcgtttcgcc
aaggtgttccagaatgtggcggaaaaagaaaaggcccggctggtgcccttcctgatggaa
ggaatcgcaacagaccgggcgctctttcaggccgatgggatacaccccaatgaaatggcc
cagcccgcattgttgaacaatgtatggccgggccttcagcccttgctatcagatcaggcc
ggaggctga

DBGET integrated database retrieval system