KEGG   Bordetella avium: BAV1980Help
Entry
BAV1980           CDS       T00695                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bav  Bordetella avium
Brite
Enzymes [BR:bav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BAV1980 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2123077..2123871)
Genome map
AA seq 264 aa AA seqDB search
MRKPVGSKDGSGVYSRQGLDGYTPANSNTRISTATLPRPEPLRPAASSANLGLNSDRLRL
AMVQRLRQMGITDDRVLDAMAAVPRHTFVDEALASRAYEDAALPIGHSQTISQPWVVARM
IAAVCEARAPSRVLEVGAGCGYQAAVLAQFVREVHSIERIRGLYELARANLRALRLSTRV
RLIYGDGTQGVPGVAPFDAIVVAAAGLAIPQALLNQLAPGGRLIAPEGSTSQRLVLIERT
GTASWKRMELEAVRFVPLKAGIQS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaacctgtaggttcgaaagacggttctggcgtttattcgcggcagggcttggat
ggctacacgccggctaacagcaatacccgcatctccaccgcgaccctgccgcgtcccgag
cccctcaggccggcggccagctcggccaatctgggcctgaattccgaccgcttgcgcctg
gccatggtgcagcgtttgcgtcagatgggcatcaccgatgaccgtgtgctcgacgcgatg
gccgcagtgcctcgccatactttcgtcgatgaggccctggcgagccgcgcctacgaagat
gccgccttgcccatcggccattctcaaaccatttctcagccctgggtcgtggcgcgcatg
attgctgccgtctgcgaggcgagggcgccgtctcgcgtgcttgaggtcggcgcgggttgc
ggctatcaggccgccgtgctcgcccagtttgtgcgcgaggtgcactccattgagcgcata
cgcggcctgtacgagttggcccgcgccaatctgcgcgccttgcggctttccacacgtgtg
cgcctgatctacggcgatggcacacagggcgtacccggcgtcgccccattcgatgctatt
gttgtggcagccgccggcctggccattccccaggcgcttctgaaccaattggcgccgggc
ggccggctgatcgcgcccgagggctcgaccagccaacgactggtattgatagaacgaact
ggcaccgcaagctggaagcgcatggagcttgaggccgtgcggttcgttcctttgaaggca
ggaatacaatcttga

DBGET integrated database retrieval system