KEGG   Bordetella avium: BAV2457Help
Entry
BAV2457           CDS       T00695                                 

Gene name
nagZ
Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bav  Bordetella avium
Pathway
bav00520  Amino sugar and nucleotide sugar metabolism
bav01100  Metabolic pathways
bav01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BAV2457 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BAV2457 (nagZ)
Enzymes [BR:bav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BAV2457 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CAJ50067
UniProt: Q2KXM7
Position
complement(2651445..2652497)
Genome map
AA seq 350 aa AA seqDB search
MSKSRKPSLLPPGPVMVDVAGGQLTEQEKQRLRHPLVGGVILFARNFENRAQLTALTQDI
HAARGEPLLIAVDHEGGRVQRFREDGFTALPAMRTLGEVWDRDPLAAMQLATQTGYVLAA
ELRACGVDMSFTPVLDLDYGVSKVIGNRAFHADPRVVAMLARALVQGLALTGMAACGKHF
PGHGYVEADSHHEIPVDTRTLADILKDDAAPYGWLGDQILPSVMPAHVIYPEVDSQPAGF
SRRWVSEILRGQLGYDGVVFSDDLTMEGASVAGDILARAQAALSAGCDMVLVCNRPDLAD
DLLERLSFTPPAVDRIRRLMPAYAAPDWDSLQADSRYQHARRIQSQIISG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagtccagaaagccttctttacttcctccgggtcctgtcatggttgacgtggca
ggcgggcagctcaccgagcaggaaaaacagcgcttgcgtcatccgctggtgggtggcgtg
attctgttcgcacgcaatttcgaaaaccgcgcccaattgactgcgctcacacaggatatt
catgcggcgcggggcgaacctttgctgatcgcggtcgatcacgagggcgggcgggtgcag
cgtttccgcgaagacggcttcaccgcgctgccggctatgcgtaccctgggcgaggtctgg
gaccgcgatccgctggccgccatgcaattggccacacagaccggctatgtgctggcggca
gagttacgcgcctgcggtgtggacatgagttttacgcccgtcctggatctggattatggg
gtgagcaaggtgatcggcaatcgtgcttttcatgccgatccgcgtgtggtggccatgctg
gcgcgcgccctggttcaaggcctggctttgacgggtatggcggcttgcggcaagcatttt
cctgggcacggctatgtcgaggcggattcgcatcatgaaattccggtcgatacccgcaca
ctggccgacatcctgaaggatgatgccgcgccttatggctggctgggtgaccagattctg
ccatcggtgatgcctgcgcatgtgatctaccccgaagttgacagccagcctgccggtttt
tcgcgccgctgggtgagcgagattttgcgtggacagttgggctacgacggtgtggtgttt
tcggatgatctgacgatggagggggcatcggtggccggcgatattctggcacgcgcgcag
gccgcgctgtcggcaggctgcgacatggtgctggtctgcaatcgccctgatctggccgac
gacttgctggagcgtttgagtttcacgccgccggccgtggaccgcatccgccgtttgatg
ccggcttatgccgcacctgattgggacagcctgcaagccgattcgcgctatcaacatgcc
cgacgaattcaatctcaaatcatttctggctga

DBGET integrated database retrieval system