KEGG   Bordetella avium: BAV2628Help
Entry
BAV2628           CDS       T00695                                 

Gene name
wssD
Definition
(GenBank) endoglucanase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
bav  Bordetella avium
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2837502..2838698)
Genome map
AA seq 398 aa AA seqDB search
MMLRLAALRLAALRLMSLVLALIAAPASAAAVCQAASWPQWQTFAQHFVQADGRVLDAST
PRQISTSEGQSYAMFFALVANDRAAFERLWRWSVANLADADATRTLPAWAWGKRDDGSWG
VLDRNAASDADLWFTYALLEAGRLWRRPDYTREGLALLNLIQNQELADLPDFGPMLLPAP
FGFVQPDGIWRLNPSYLPIPVLRRLALAAPGGPWTKIAANTVRLIQATTPKGFAADWVAY
QSTAQIAGQFVADPVHGYRGSYDAIRTYMWAGMTPAADPAAQPLRAALYGMAAATLAAGV
PPESVQTDTGVVQGSGPFGFSAALLPYLEAEGRDAELRTQLARVRAAWTQSLEPGNLALR
QPSYYDYVLSLFGTGWYEQRYRFGTTGRLSLEWEKKCP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgatgctgcgcctggctgctctgcgcctggctgctctgcgcctgatgtcgctggtgctg
gctctgatcgccgcgccagcgtcggcggctgccgtctgtcaggcggcaagctggccgcaa
tggcaaaccttcgcccagcatttcgtgcaggcggatggccgggtgctcgacgccagcacg
ccgcgtcagatcagcacctccgaggggcagtcgtatgccatgttttttgccttggtggct
aacgatcgtgctgccttcgagcgtctgtggcgttggagcgtggccaatctggccgacgcc
gatgccacgcgtaccctgcccgcctgggcctggggcaagcgcgatgatggcagttggggg
gtgctggaccgcaatgcggcttcggatgcggatctctggtttacctacgccttgctcgaa
gctggccggctttggcggcggcccgattacacccgcgaaggcctcgccttactgaacttg
attcagaaccaggagctcgctgacctgccggacttcggccccatgctgcttcctgcgcca
tttggtttcgtgcagcccgacggaatctggcggctcaatccgagctatctgcctattccg
gtgttgcgccgtctggccctggctgcgcccggtgggccctggacaaagattgcggcgaac
acggtccgtttgatccaggccacgacgcccaaaggttttgcagcggactgggtggcttac
cagagcacggcacagatcgcggggcagtttgtggccgaccctgtccatggctaccgaggc
agctacgacgccatacgcacttatatgtgggcgggcatgacgccggccgccgatcccgcg
gctcagcccttgcgtgctgcgctctatggcatggcggcggcaacgcttgcggctggcgtg
ccgccagagtcggtgcagacggacacgggcgtggtgcagggcagcggtcccttcggtttt
tccgcagcgctcttgccctatctggaagcggagggccgcgacgccgagttgcggacccag
cttgcccgggtcagggcagcttggacgcaaagccttgagcctggcaatctcgcgttgcgc
cagccttcttattacgattatgttctgagcctgttcggcacaggttggtacgaacagcgt
taccggtttggcaccaccggtcgcctgtcactggagtgggaaaagaaatgtccttga

DBGET integrated database retrieval system